LOADING...
   TM1246;TM1246
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1246    TM1246            JCSG 283111 PDB Deposition 04-APR-23              PDB id: 1vk3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1246
DESCRIPTIONPhosphoribosylformylglycinamidine synthase II (EC 6.3.5.3) (FGAM synthase II).
ORGANISMThermotoga maritima
COMMENTPerfect genome and functional context: clustering on a chromosome with another enzymes of
De novo Purine biosynthesis subsystem:
TM1244 - Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3)
TM1245 - Phosphoribosylformylglycinamidine synthase, purL subunit (EC 6.3.5.3)
TM1247 - Amidophosphoribosyltransferase (EC 2.4.2.14)
TM1248 - Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)
TM1249 - Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) / IMP cyclohydrolase (EC 3.5.4.10)
TM1250 - Phosphoribosylamine--glycine ligase (EC 6.3.4.13)
TM1251 - Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)

-!- CATALYTIC ACTIVITY: ATP + N(2)-FORMYL-N(1)-(5-PHOSPHO-D-
RIBOSYL)GLYCINAMIDE + L-GLUTAMINE + H(2)O = ADP + PHOSPHATE + 2-
(FORMAMIDO)-N(1)-(5-PHOSPHO-D-RIBOSYL)ACETAMIDINE + L-GLUTAMATE.
-!- PATHWAY: DE NOVO PURINE BIOSYNTHESIS; FOURTH STEP.
-!- SUBUNIT: HETERODIMER OF TWO SUBUNITS, PURQ AND PURL.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE FGAMS FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PURL_THEMA
DR SPTR; Q9X0X3 (flat text); Q9X0X3 (good view)
DR GenBank; AAD36321
DR Pfam; PF02769; AIRS_C;
DR Pfam; PF00586; AIRS;
DR Interpro; IPR000728; AIR_synth;
DR PDB; 2HS0; Identical; 09-JAN-07; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 2HS3; Identical; 09-JAN-07; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 2HS4; Identical; 09-JAN-07; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 1VK3; Identical; 11-MAY-04; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 2HRU; Identical; 09-JAN-07; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 2HRY; Identical; 09-JAN-07; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II;
DR PDB; 3VIU; Highly similar; 18-JAN-12; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 2;
DR KEGG; 6.3.5.3; Enzyme page
DR FFAS; 283111; Fold and function assignment.
DR TVPC; TM1246; Homologs in PDB, JCSG and SG center.
DR OVP; TM1246; Ortholog view popup.
DR TPM; TM1246; Target PDB monitor.
DR FSS; TM1246; Target function coverage.
PROPERTY Residues: 603 aa
Molecule Weight: 65965.23 Dalton
Isoelectric Point: 5.38
Extinction Coefficient: 54320
Gravy Index: -.05
Number of Met residues: 17
Percentage of Met residues: 2.82 %
Number of Cys residues: 3
Percentage of Cys residues: 0.50 %
SEQUENCE  amino acids 603 aa
>TM1246  TM1246 phosphoribosylformylglycinamidine synthase II (purL)
MKLRYLNILKEKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTGFEGNAGVVNLD
DYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSRIIDGIIE
GIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRPGQVIVIFGG
ATGRDGIHGASFASEDLTGDKATKLSIQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAG
GVLSATSELVAKGNLGAIVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEI
ARKHLLFGDVVAEVIEEPVYRVMYRNDLVMEVPVQLLANAPEEDIVEYTPGKIPEFKRVE
FEEVNAREVFEQYDHMVGTDTVVPPGFGAAVMRIKRDGGYSLVTHSRADLALQDTYWGTL
IAVLESVRKTLSVGAEPLAITNCVNYGDPDVDPVGLSAMMTALKNACEFSGVPVASGNAS
LYNTYQGKPIPPTLVVGMLGKVNPQKVAKPKPSKVFAVGWNDFELEREKELWRAIRKLSE
EGAFILSSSQLLTRTHVETFREYGLKIEVKLPEVRPAHQMVLVFSERTPVVDVPVKEIGT
LSR

CDS  cDNA 1809 bp
   1 atgaagttga gatatctgaa cattctcaag gagaagcttg gaagagaacc caccttcgtc    60
  61 gagcttcagg ctttttcagt catgtggagc gaacactgtg gatactccca cacgaagaaa   120
 121 tacataagaa gattaccgaa aacgggtttt gagggaaacg cgggtgtggt gaacctggat   180
 181 gattactatt ccgttgcttt caagatagag agccacaatc acccgagtgc gatagaacct   240
 241 tacaacggtg cagcaacggg tgtcggtgga atcatcagag acgtcctcgc gatgggagcc   300
 301 cgcccaacgg ccatattcga ttcactccac atgtcccgaa tcatagacgg tatcatagag   360
 361 ggaatagccg attacggtaa ttccataggc gttccaacgg tcggtggaga actcaggatc   420
 421 tcctcactat acgcgcacaa ccccctcgtg aacgtgctcg cagcgggtgt tgtgagaaac   480
 481 gacatgctgg tcgattcgaa agcatcgaga ccgggacagg tcatagtgat cttcggagga   540
 541 gccacaggaa gggacggaat ccacggggcg tctttcgctt cggaggatct cacgggtgat   600
 601 aaggcaacca agctttcaat tcaggttggt gacccgttcg ctgaaaagat gctcatagaa   660
 661 gcgttcctgg agatggtgga agagggactc gtggaaggag ctcaggatct gggagcgggc   720
 721 ggtgtgctgt ccgcaacttc ggaactcgta gcgaagggga atctcggagc gatcgttcat   780
 781 ctggaccgtg ttcccctgag agaaccggat atggagccct gggaaatcct cataagcgaa   840
 841 agccaagaaa gaatggcggt cgtcacatca cctcagaagg cgagccgcat tctggaaata   900
 901 gccaggaagc accttctttt cggcgatgtc gttgccgaag tgatagaaga accagtttac   960
 961 agggtgatgt acagaaacga tctcgtcatg gaagttcccg tccagctcct cgcaaacgcc  1020
1021 ccagaagagg acatagtcga atacacaccc ggaaagatcc cagagttcaa aagggtggaa  1080
1081 ttcgaagagg tgaacgcgag ggaagtcttc gagcagtacg atcacatggt cggaacggat  1140
1141 accgtggttc cacccggatt cggcgcggcc gtgatgagaa taaagagaga cggggggtac  1200
1201 tccctcgtca cacacagcag ggcggatctg gctcttcagg atacctactg gggaaccctc  1260
1261 atagccgtgc tcgagagtgt gagaaagacg ctcagcgttg gtgcggaacc cctcgctata  1320
1321 acgaactgcg tgaactacgg ggatcccgat gttgatccgg tgggactttc ggccatgatg  1380
1381 accgctctca agaacgcttg cgaattctcc ggtgttcccg ttgcatcggg aaacgcttct  1440
1441 ctctacaaca cgtaccaggg aaaacccatt ccacccaccc tggttgtggg aatgttgggg  1500
1501 aaggtgaacc cgcagaaagt ggcaaaaccg aagccttcga aggtgttcgc ggtgggatgg  1560
1561 aacgacttcg aactcgaaag ggaaaaagaa ctctggagag ccataagaaa actctcagaa  1620
1621 gaaggtgctt tcatcctctc ttcgtcacag cttctgacga gaactcacgt ggagactttc  1680
1681 agagagtacg gcttgaagat cgaagtgaaa ctgccagaag tgaggccggc gcatcagatg  1740
1741 gtgctcgtct tctctgagag aactcccgta gtcgatgttc ctgtgaagga gatcggaacg  1800
1801 ctctcgagg  1809
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1270490 1272301 2 Glimmer3 score - -
Genemark probabilities .98   .98 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu