LOADING...
   TM1244;TM1244
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1244    TM1244            JCSG 283109 PDB Deposition 04-DEC-15              PDB id: 1vq3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1244
DESCRIPTIONPhosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3)
ORGANISMThermotoga maritima
COMMENTPerfect genome and functional context: clustering on a chromosome with another enzymes of De novo Purine biosynthesis subsystem:
TM1245 - Phosphoribosylformylglycinamidine synthase, purL subunit (EC 6.3.5.3)
TM1246 - Phosphoribosylformylglycinamidine synthase, purQ subunit (EC 6.3.5.3)
TM1247 - Amidophosphoribosyltransferase (EC 2.4.2.14)
TM1248 - Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)
TM1249 - Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) / IMP cyclohydrolase (EC 3.5.4.10)
TM1250 - Phosphoribosylamine--glycine ligase (EC 6.3.4.13)
TM1251 - Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)
DR UNIPROT; Q9X0X1_THEMA
DR SPTR; Q9X0X1 (flat text); Q9X0X1 (good view)
DR GenBank; AAD36319
DR Pfam; PF02700; PurS;
DR Interpro; IPR003850; UPF0062;
DR PDB; 1VQ3; Identical; 28-DEC-04; PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE, PURS CHAIN: A, B;
DR PDB; 2ZW2; Highly similar; 17-NOV-09; PUTATIVE UNCHARACTERIZED PROTEIN STS178;
DR PDB; 2CUW; Highly similar; 30-NOV-05; PURS;
DR PDB; 2DGB; Highly similar; 10-SEP-06; HYPOTHETICAL PROTEIN PURS;
DR PDB; 1TWJ; Highly similar; 31-AUG-04; HYPOTHETICAL UPF0062 PROTEIN YEXA;
DR PDB; 1T4A; Highly similar; 14-SEP-04; PURS;
DR KEGG; 6.3.5.3; Enzyme page
DR FFAS; 283109; Fold and function assignment.
DR TVPC; TM1244; Homologs in PDB, JCSG and SG center.
DR OVP; TM1244; Ortholog view popup.
DR TPM; TM1244; Target PDB monitor.
DR FSS; TM1244; Target function coverage.
PROPERTY Residues: 82 aa
Molecule Weight: 9638.72 Dalton
Isoelectric Point: 5.91
Extinction Coefficient: 4470
Gravy Index: -.59
Number of Met residues: 1
Percentage of Met residues: 1.22 %
Number of Cys residues: 1
Percentage of Cys residues: 1.22 %
SEQUENCE  amino acids 82 aa
>TM1244  TM1244 conserved hypothetical protein
MPLFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEI
VKKACEELLVNPVVEEYEVREL

CDS  cDNA 246 bp
   1 ttgccgctct ttaaattcgc aatagacgtt cagtacagga gcaacgtgag ggatccgcgc    60
  61 ggagaaacga tcgaacgtgt tctgagggaa gaaaaaggtc ttcccgtgaa aaagttgaga   120
 121 cttgggaagt ccatccacct cgaagtagaa gcagaaaaca aagaaaaagc gtacgaaatc   180
 181 gtaaagaaag cctgcgaaga actcctggtg aacccggttg ttgaggaata tgaggtgagg   240
 241 gagctg   246
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1269604 1269852 1 Glimmer3 score 15.71 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu