LOADING...
   TM1225;TM1225
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1225    TM1225            JCSG 283090 PDB Deposition 04-MAY-12              PDB id: 1vkd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1225
DESCRIPTIONPredicted glycosidase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0V2_THEMA
DR SPTR; Q9X0V2 (flat text); Q9X0V2 (good view)
DR GenBank; AAD36300
DR Pfam; PF04041; DUF377;
DR Interpro; IPR007184; DUF377;
DR PDB; 1VKD; Identical; 25-MAY-04; CONSERVED HYPOTHETICAL PROTEIN TM1225;
DR KEGG; 3.; Enzyme page
DR FFAS; 283090; Fold and function assignment.
DR TVPC; TM1225; Homologs in PDB, JCSG and SG center.
DR OVP; TM1225; Ortholog view popup.
DR TPM; TM1225; Target PDB monitor.
DR FSS; TM1225; Target function coverage.
PROPERTY Residues: 326 aa
Molecule Weight: 37256.32 Dalton
Isoelectric Point: 5.66
Extinction Coefficient: 75290
Gravy Index: -.32
Number of Met residues: 5
Percentage of Met residues: 1.53 %
Number of Cys residues: 4
Percentage of Cys residues: 1.23 %
SEQUENCE  amino acids 326 aa
>TM1225  TM1225 conserved hypothetical protein
MKVFTEKIPNIPWEERPEGYTGPVWRYSKNPIIGRNPVPKGARVFNSAVVPYNGEFVGVF
RIDHKNTRPFLHFGRSKDGINWEIEPEEIQWVDVNGEPFQPSYAYDPRVVKIEDTYYITF
CTDDHGPTIGVGMTKDFKTFVRLPNAYVPFNRNGVLFPRKINGKYVMLNRPSDNGHTPFG
DIFLSESPDMIHWGNHRFVLGRSSYNWWENLKIGAGPYPIETSEGWLLIYHGVTLTCNGY
VYSFGAALLDLDDPSKVLYRSRYYLLTPEEEYETVGFVPNVVFPCAALCDADTGRVAIYY
GAADTHVALAFGYIDEIVDFVKRNSM

CDS  cDNA 978 bp
   1 atgaaagtgt ttacggagaa aattccaaac attccctggg aagaaaggcc ggaaggctac    60
  61 actggtcctg tgtggagata cagcaaaaac ccgataattg gaagaaaccc ggttccaaag   120
 121 ggagcaagag tcttcaactc cgcagttgta ccgtacaacg gagagtttgt gggggtgttc   180
 181 aggatcgatc acaagaacac aaggcccttc cttcacttcg gaaggagtaa agacggaata   240
 241 aactgggaaa tagagccaga agagatacag tgggtggatg tgaatggaga accgttccag   300
 301 ccgagttacg cttacgatcc aagggtagtg aagatagagg atacttacta cataaccttc   360
 361 tgtacagacg accacggccc cacgattgga gtgggcatga ccaaggattt caaaacgttc   420
 421 gttcgacttc cgaacgctta cgttccattc aacagaaacg gagttctctt cccaaggaag   480
 481 ataaatggga aatatgtgat gctcaacaga ccgagcgaca acggtcacac cccgtttgga   540
 541 gacatatttc tcagtgaaag ccccgatatg atacactggg gtaaccacag gttcgtcttg   600
 601 ggaagaagca gttacaactg gtgggagaac ctcaaaatag gagcgggacc gtatccaata   660
 661 gaaaccagcg aaggatggct gctcatatac cacggtgtga cactcacctg caacggctac   720
 721 gtgtacagtt ttggagcagc tctcctcgat ctcgacgatc ccagcaaggt tctctacagg   780
 781 tcgaggtact atcttctgac gccggaagaa gagtacgaaa cggtgggctt cgttccaaac   840
 841 gttgtctttc cgtgtgccgc gctctgcgac gccgacacag gaagagttgc aatatactac   900
 901 ggtgcggcag acacccacgt ggcccttgca tttggataca tcgacgagat cgtggatttt   960
 961 gtgaaaagaa attctatg   978
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1248938 1249918 -2 Glimmer3 score 9.86 poor
Genemark probabilities .93   .72 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu