LOADING...
   TM1224;TM1224
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1224    TM1224            JCSG 359804 PDB Deposition 06-JUL-14              PDB id: 2hoe

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1224
DESCRIPTIONN-acetylglucosamine kinase (EC 2.7.1.59) / predicted N-acetylglucosamine repressor
ORGANISMThermotoga maritima
COMMENTTM1224 (NAGK nagC) is predicted to be a bifunctional protein.
Prediction based on pathway analysis
and domain structure: N-domain =HTH; C-domain = sugar kinase, ROK family.
Experimental verification in progress (Osterman Lab., The Burnham Institute).
Belongs to Subsystem: N-Acetyl-D-Glucosamine Utilization.
This subsystem includes:
- degradation of chitobiose;
- recyling of endogenous N-Ac-glucosamine
- uptake and utilization of exogenous N-Ac-glucosamine
The corresponding KEGG map is "Aminosugars metabolism".
Functionally related with another subsystem: Biosynthesis of UDP-N-acetylmuramate from Fructose-6-phosphate.
DR UNIPROT; Q9X0V1_THEMA
DR SPTR; Q9X0V1 (flat text); Q9X0V1 (good view)
DR GenBank; AAD36299
DR Pfam; PF00480; ROK;
DR Interpro; IPR000600; ROK;
DR PDB; 2HOE; Identical; 15-AUG-06; N-ACETYLGLUCOSAMINE KINASE;
DR KEGG; 2.7.1.59; Enzyme page
DR FFAS; 283089; Fold and function assignment.
DR TVPC; TM1224; Homologs in PDB, JCSG and SG center.
DR OVP; TM1224; Ortholog view popup.
DR TPM; TM1224; Target PDB monitor.
DR FSS; TM1224; Target function coverage.
PROPERTY Residues: 368 aa
Molecule Weight: 40884.93 Dalton
Isoelectric Point: 5.57
Extinction Coefficient: 34380
Gravy Index: -.07
Number of Met residues: 9
Percentage of Met residues: 2.45 %
Number of Cys residues: 3
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 368 aa
>TM1224  TM1224 transcriptional regulator, XylR-related
MPKSVRAENISRILKRIMKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSPKG
VGRPTKSLKISPNCAYVLGIEVTRDEIAACLIDASMNILAHEAHPLPSQSDREETLNVMY
RIIDRAKDMMEKLGSKLSALTVAAPGPIDTERGIIIDPRNFPLSQIPLANLLKEKYGIEV
WVENDADMGAVGEKWYTKRDDSFAWILTGKGIGAGIIIDGELYRGENGYAGEIGYTRVFN
GNEYVFLEDVCNENVVLKHVLSMGFSSLAEARDSGDVRVKEYFDDIARYFSIGLLNLIHL
FGISKIVIGGFFKELGENFLKKIKIEVETHLLYKHSVDMSFSKVQEPVIAFGAAVHALEN
YLERVTTS

CDS  cDNA 1104 bp
   1 ttgccgaaat cggtgagagc agaaaacata tcgaggattc tgaaacgaat aatgaaatca    60
  61 cccgtgtcgc gtgtagaact cgcggaggaa ctcggtctca ccaagaccac agttggtgag   120
 121 atcgcaaaga tattcctgga gaaggggatc gtcgttgaag agaaagattc tccgaagggg   180
 181 gtgggaagac ccacaaaatc tttgaaaatc tcaccgaatt gtgcttatgt tctcggtata   240
 241 gaggtgacga gggacgaaat agctgcctgt ctcatagatg ccagtatgaa cattctcgca   300
 301 cacgaagcac atcctcttcc atctcagagc gatagagagg aaacgttgaa tgtcatgtac   360
 361 agaattatag accgcgcaaa agatatgatg gaaaaactcg gcagtaaact ttcagcgttg   420
 421 acagtggcag ctcctggacc gatagatact gaaagaggca tcatcataga tccgagaaac   480
 481 tttccacttt cacagattcc tctggcgaac cttttgaaag agaagtacgg catcgaggtc   540
 541 tgggtggaga acgacgcgga catgggagcc gtgggagaaa agtggtatac aaagcgggat   600
 601 gactctttcg cctggatcct gacaggaaag ggaataggag ctggcatcat catcgatgga   660
 661 gaactctacc ggggagaaaa cggatacgca ggagagatcg gatacaccag ggttttcaat   720
 721 ggaaacgagt acgtcttcct ggaagatgtg tgcaacgaaa atgttgttct gaaacacgtt   780
 781 ctttctatgg gattcagctc tctggctgaa gcaagagatt ctggtgatgt tcgcgtgaaa   840
 841 gagtactttg atgacatagc gaggtatttc agtataggtc ttttgaattt gatacatctt   900
 901 tttgggatat cgaagatcgt cataggaggg tttttcaaag aacttggtga gaattttctg   960
 961 aaaaagatca aaatcgaagt ggaaacacac cttctttaca aacacagtgt ggacatgagt  1020
1021 ttttcgaaag tgcaggaacc ggtgatcgcc tttggagcag ccgtacacgc actggaaaat  1080
1081 tatctcgaga gagtaacaac gagt  1104
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1247818 1248924 -1 Glimmer3 score 11.24 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu