LOADING...
   TM1223;TM1223
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1223    TM1223            JCSG 358463 PDB Deposition 05-FEB-11              PDB id: 1vr5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1223
DESCRIPTIONOligopeptide ABC transporter, periplasmic oligopeptide-binding
protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0V0_THEMA
DR SPTR; Q9X0V0 (flat text); Q9X0V0 (good view)
DR GenBank; AAD36298
DR Pfam; PF00496; SBP_bac_5;
DR Interpro; IPR000914; SBP_bac_5;
DR PDB; 1VR5; Identical; 08-MAR-05; OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC OLIGOPEPTIDE-BINDI;
DR PDB; 4PFT; Identical; 17-SEP-14; ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN;
DR PDB; 4PFY; Identical; 17-SEP-14; ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN;
DR PDB; 4PFU; Highly similar; 17-SEP-14; ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN;
DR PDB; 4PFW; Highly similar; 17-SEP-14; ABC TRANSPORTER SUBSTRATE-BINDING PROTEIN;
DR PDB; 2O7I; Highly similar; 20-MAR-07; OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC OLIGOPEPTIDE-BINDI;
DR PDB; 3I5O; Highly similar; 21-JUL-09; OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC OLIGOPE BINDING PR;
DR PDB; 4JSD; Highly similar; 09-OCT-13; OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC OLIGOPE BINDING PR;
DR FFAS; 283088; Fold and function assignment.
DR TVPC; TM1223; Homologs in PDB, JCSG and SG center.
DR OVP; TM1223; Ortholog view popup.
DR TPM; TM1223; Target PDB monitor.
DR FSS; TM1223; Target function coverage.
PROPERTY Residues: 557 aa
Molecule Weight: 64075.04 Dalton
Isoelectric Point: 5.08
Extinction Coefficient: 193660
Gravy Index: -.29
Number of Met residues: 10
Percentage of Met residues: 1.80 %
Number of Cys residues: 2
Percentage of Cys residues: 0.36 %
SEQUENCE  amino acids 557 aa
>TM1223  TM1223 oligopeptide ABC transporter, periplasmic oligopeptide-binding protein
MKRFLVVLVLVLALVSVFGQTFERNKTLYWGGALWSPPSNWNPFTPWNAVAGTIGLVYEP
LFLYDPLNDKFEPWLAEKGEWVSNNEYVLTLRKGLRWQDGVPLTADDVVFTFEIAKKYTG
ISYSPVWNWLGRIERVDERTLKFVFSDPRYQEWKQMLINTPIVPKHIWENKTEEEVLQAA
NENPVGSGPYYVESWADDRCVFKKNGNWWGIRELGYDPKPERIVELRVLSNNVAVGMLMK
GELDWSNFFLPGVPVLKKAYGIVTWYENAPYMLPANTAGIYINVNKYPLSIPEFRRAMAY
AINPEKIVTRAYENMVTAANPAGILPLPGYMKYYPKEVVDKYGFKYDPEMAKKILDELGF
KDVNKDGFREDPNGKPFKLTIECPYGWTDWMVSIQSIAEDLVKVGINVEPKYPDYSKYAD
DLYGGKFDLILNNFTTGVSATIWSYFNGVFYPDAVESEYSYSGNFGKYANPEVETLLDEL
NRSNDDAKIKEVVAKLSEILLKDLPFIPLWYNGAWFQASEAVWTNWPTEKNPYAVPIGWN
GWWQLTGIKTLFGIEAK

CDS  cDNA 1671 bp
   1 atgaaaaggt ttttagtcgt tctcgttctg gtcctggcac tggtttcggt tttcggacag    60
  61 acttttgaga gaaacaaaac gctctactgg ggtggagcgc tgtggtctcc tccatccaac   120
 121 tggaacccgt tcacaccatg gaacgcggtt gcgggaacca tcggtcttgt ctatgaacct   180
 181 ctgttcctct acgatcctct gaacgacaag ttcgagccgt ggcttgcaga aaaaggagaa   240
 241 tgggtcagca acaacgaata cgtactcacg ctcagaaagg gtctcagatg gcaggacgga   300
 301 gttcctctca cggcagacga cgtggttttc acctttgaaa tcgccaagaa gtacactggt   360
 361 atcagctaca gtcctgtgtg gaactggctc ggcaggatcg aaagggtcga tgaacgaacg   420
 421 ctgaagttcg tcttctccga cccgaggtac caggaatgga aacagatgct catcaacaca   480
 481 ccgatcgtac caaaacacat ctgggaaaac aaaacagagg aagaagttct tcaggcggcc   540
 541 aatgaaaatc cagttggatc cggtccgtac tacgttgaaa gctgggcaga cgacagatgt   600
 601 gtattcaaga agaacgggaa ctggtggggc atcagagaac tcggttacga tcccaaacct   660
 661 gaaaggatcg tggaactgag agtgctcagc aacaatgtcg cagtaggaat gctcatgaaa   720
 721 ggagaactcg actggagcaa cttcttcctg ccgggtgttc cggttttgaa gaaagcatac   780
 781 ggaatcgtca cctggtatga aaacgctcct tacatgctcc cggccaacac cgcaggaatc   840
 841 tacatcaacg tgaataagta tcctctcagc atacctgagt tcagaagagc aatggcttac   900
 901 gctatcaatc ccgagaagat cgttaccaga gcttacgaga acatggtgac ggctgccaat   960
 961 cccgctggaa tcctgccgct tcccggttac atgaagtact atccgaaaga agtcgtcgat  1020
1021 aagtacggat tcaagtacga tccggagatg gcaaagaaga tcctcgacga gcttggattc  1080
1081 aaagatgtga acaaggatgg attcagagaa gatccgaacg gaaagccgtt caagctcacg  1140
1141 attgagtgtc cgtacggatg gaccgactgg atggtttcta tccagtccat tgcagaagat  1200
1201 ctcgtgaaag tcggaatcaa cgtcgaacct aaataccccg actactccaa atacgcagac  1260
1261 gacctctacg gtggaaagtt cgatctcata ctcaacaact ttacaaccgg tgtttccgct  1320
1321 accatctggt cctatttcaa cggtgtgttc tatccggatg cagtagaatc cgagtactcc  1380
1381 tactccggaa actttggaaa gtacgccaat cctgaagttg agactcttct cgacgaactc  1440
1441 aacagaagca atgatgatgc taaaattaaa gaagtagtag ccaagctgtc agagatactg  1500
1501 ctcaaggatc tgccgttcat tcctctgtgg tacaacggtg catggttcca ggcttctgaa  1560
1561 gctgtgtgga ccaactggcc aacggagaag aatccgtacg ctgtcccgat aggctggaac  1620
1621 ggctggtggc agctcacagg aatcaagacg ctctttggta ttgaagcaaa g  1671
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1246013 1247686 -2 Glimmer3 score 12.88 good
Genemark probabilities .96   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu