LOADING...
   TM1192;TM1192
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1192    TM1192            JCSG 359818 PDB Deposition 05-JUN-09              PDB id: 1zy9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1192
DESCRIPTIONAlpha-galactosidase (EC 3.2.1.22) (Melibiase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: MELIBIOSE + H(2)O = GALACTOSE + GLUCOSE.
-!- COFACTOR: MAGNESIUM; NAD.
DR UNIPROT; O33835_THEMA
DR SPTR; O33835 (flat text); O33835 (good view)
DR GenBank; CAA04514
DR Interpro; IPR003016; Lipoyl_BS;
DR PDB; 1ZY9; Identical; 12-JUL-05; ALPHA-GALACTOSIDASE;
DR KEGG; 3.2.1.22; Enzyme page
DR FFAS; 283057; Fold and function assignment.
DR TVPC; TM1192; Homologs in PDB, JCSG and SG center.
DR OVP; TM1192; Ortholog view popup.
DR TPM; TM1192; Target PDB monitor.
DR FSS; TM1192; Target function coverage.
PROPERTY Residues: 552 aa
Molecule Weight: 63653.26 Dalton
Isoelectric Point: 5.22
Extinction Coefficient: 112300
Gravy Index: -.39
Number of Met residues: 9
Percentage of Met residues: 1.63 %
Number of Cys residues: 6
Percentage of Cys residues: 1.09 %
SEQUENCE  amino acids 552 aa
>TM1192  TM1192 alpha-galactosidase (galA)
MEIFGKTFREGRFVLKEKNFTVEFAVEKIHLGWKISGRVKGSPGRLEVLRTKAPEKVLVN
NWQSWGPCRVVDAFSFKPPEIDPNWRYTASVVPDVLERNLQSDYFVAEEGKVYGFLSSKI
AHPFFAVEDGELVAYLEYFDVEFDDFVPLEPLVVLEDPNTPLLLEKYAELVGMENNARVP
KHTPTGWCSWYHYFLDLTWEETLKNLKLAKNFPFEVFQIDDAYEKDIGDWLVTRGDFPSV
EEMAKVIAENGFIPGIWTAPFSVSETSDVFNEHPDWVVKENGEPKMAYRNWNKKIYALDL
SKDEVLNWLFDLFSSLRKMGYRYFKIDFLFAGAVPGERKKNITPIQAFRKGIETIRKAVG
EDSFILGCGSPLLPAVGCVDGMRIGPDTAPFWGEHIEDNGAPAARWALRNAITRYFMHDR
FWLNDPDCLILREEKTDLTQKEKELYSYTCGVLDNMIIESDDLSLVRDHGKKVLKETLEL
LGGRPRVQNIMSEDLRYEIVSSGTLSGNVKIVVDLNSREYHLEKEGKSSLKKRVVKREDG
RNFYFYEEGERE

CDS  cDNA 1656 bp
   1 gtggaaatat tcggaaagac cttcagagag ggaagattcg ttctcaaaga gaaaaacttc    60
  61 acagttgagt tcgcggtgga gaagatacac cttggctgga agatctccgg cagggtgaag   120
 121 ggaagtccgg gaaggcttga ggttcttcga acgaaagcac cggaaaaggt acttgtgaac   180
 181 aactggcagt cctggggacc gtgcagggtg gtcgatgcct tttctttcaa accacctgaa   240
 241 atagatccga actggagata caccgcttcg gtggtgcccg atgtacttga aaggaacctc   300
 301 cagagcgact atttcgtggc tgaagaagga aaagtgtacg gttttctgag ttcgaaaatc   360
 361 gcacatcctt tcttcgctgt ggaagatggg gaacttgtgg catacctcga atatttcgat   420
 421 gtcgagttcg acgactttgt tcctcttgaa cctctcgttg tactcgagga tcccaacaca   480
 481 ccccttcttc tggagaaata cgcggaactc gtcggaatgg aaaacaacgc gagagttcca   540
 541 aaacacacac ccactggatg gtgcagctgg taccattact tccttgatct cacctgggaa   600
 601 gagaccctca agaacctgaa gctcgcgaag aatttcccgt tcgaggtctt ccagatagac   660
 661 gacgcctacg aaaaggacat aggtgactgg ctcgtgacaa gaggagactt tccatcggtg   720
 721 gaagagatgg caaaagttat agcggaaaac ggtttcatcc cgggcatatg gaccgccccg   780
 781 ttcagtgttt ctgaaacctc ggatgtattc aacgaacatc cggactgggt agtgaaggaa   840
 841 aacggagagc cgaagatggc ttacagaaac tggaacaaaa agatatacgc cctcgatctt   900
 901 tcgaaagatg aggttctgaa ctggcttttc gatctcttct catctctgag aaagatgggc   960
 961 tacaggtact tcaagatcga ctttctcttc gcgggtgccg ttccaggaga aagaaaaaag  1020
1021 aacataacac caattcaggc gttcagaaaa gggattgaga cgatcagaaa agcggtggga  1080
1081 gaagattctt tcatcctcgg atgcggctct ccccttcttc ccgcagtggg atgcgtcgac  1140
1141 gggatgagga taggacctga cactgcgccg ttctggggag aacatataga agacaacgga  1200
1201 gctcccgctg caagatgggc gctgagaaac gccataacga ggtacttcat gcacgacagg  1260
1261 ttctggctga acgaccccga ctgtctgata ctgagagagg agaaaacgga tctcacacag  1320
1321 aaggaaaagg agctctactc gtacacgtgt ggagtgctcg acaacatgat catagaaagc  1380
1381 gatgatctct cgctcgtcag agatcatgga aaaaaggttc tgaaagaaac gctcgaactc  1440
1441 ctcggtggaa gaccacgggt tcaaaacatc atgtcggagg atctgagata cgagatcgtc  1500
1501 tcgtctggca ctctctcagg aaacgtcaag atcgtggtcg atctgaacag cagagagtac  1560
1561 cacctggaaa aagaaggaaa gtcctccctg aaaaaaagag tcgtcaaaag agaagacgga  1620
1621 agaaacttct acttctacga agagggtgag agagaa  1656
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1209118 1210776 -1 Glimmer3 score 13.45 good
Genemark probabilities .96   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu