LOADING...
   TM1185;TM1185
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1185    TM1185            JCSG 283050 PDB Deposition 04-SEP-20              PDB id: 1vmd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1185
DESCRIPTIONMethylglyoxal synthase (EC 4.2.3.3) (MGS).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: GLYCERONE PHOSPHATE = METHYLGLYOXAL +
PHOSPHATE.
-!- SIMILARITY: BELONGS TO THE METHYLGLYOXAL SYNTHASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT;
DR SPTR; Q9X0R7 (flat text); Q9X0R7 (good view)
DR GenBank; AAD36260
DR Pfam; PF02142; MGS;
DR Interpro; IPR004363; Methylgl_synth;
DR Interpro; IPR004362; MGS_like;
DR PDB; 1VMD; Identical; 28-SEP-04; METHYLGLYOXAL SYNTHASE;
DR PDB; 1B93; Highly similar; 16-MAR-99; PROTEIN (METHYLGLYOXAL SYNTHASE);
DR PDB; 1EGH; Highly similar; 01-MAR-00; METHYLGLYOXAL SYNTHASE;
DR PDB; 1IK4; Highly similar; 26-SEP-01; METHYLGLYOXAL SYNTHASE;
DR PDB; 1S89; Highly similar; 30-MAR-04; METHYLGLYOXAL SYNTHASE;
DR PDB; 1S8A; Highly similar; 30-MAR-04; METHYLGLYOXAL SYNTHASE;
DR PDB; 2X8W; Highly similar; 23-MAR-11; METHYLGLYOXAL SYNTHASE;
DR PDB; 2XW6; Highly similar; 09-NOV-11; METHYLGLYOXAL SYNTHASE;
DR KEGG; 4.2.3.3; Enzyme page
DR FFAS; 283050; Fold and function assignment.
DR TVPC; TM1185; Homologs in PDB, JCSG and SG center.
DR OVP; TM1185; Ortholog view popup.
DR TPM; TM1185; Target PDB monitor.
DR FSS; TM1185; Target function coverage.
PROPERTY Residues: 166 aa
Molecule Weight: 19091.04 Dalton
Isoelectric Point: 6.44
Extinction Coefficient: 18450
Gravy Index: -.36
Number of Met residues: 4
Percentage of Met residues: 2.41 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 166 aa
>TM1185  TM1185 methylglyoxal synthase
MSDRPRRYKIFMDKKKRIALIAHDRRKRDLLEWVSFNLGTLSKHELYATGTTGALLQEKL
GLKVHRLKSGPLGGDQQIGAMIAEGKIDVLIFFWDPLEPQAHDVDVKALIRIATVYNIPV
AITRSTADFLISSPLMNDVYEKIQIDYEEELERRIRKVVEGEEEET

CDS  cDNA 498 bp
   1 atgtctgaca gaccaagaag gtacaagata tttatggaca aaaagaagag gatcgctctc    60
  61 atagcacatg acagaagaaa gagagatctt cttgagtggg tgagcttcaa tcttggaacg   120
 121 ctctccaaac acgagcttta cgctacaggt acaaccggcg ctctccttca ggaaaaactc   180
 181 ggtctcaaag tacaccgact gaaaagcgga cccctcggtg gagatcagca gatcggtgca   240
 241 atgatcgccg aagggaagat agacgtgctc atattcttct gggatcctct ggaacctcag   300
 301 gcacacgacg tggatgtgaa agcgctcatc aggatagcca cagtgtacaa catccccgtc   360
 361 gccatcacaa gatccacagc ggacttcttg atctcctcac cgctcatgaa cgatgtgtac   420
 421 gagaagattc agatagacta cgaagaagaa ctggaaagaa gaatcagaaa agtggtggaa   480
 481 ggcgaggagg aagagact   498
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1201330 1201830 1 Glimmer3 score - -
Genemark probabilities .9   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu