LOADING...
   TM1171;TM1171
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1171    TM1171            JCSG 283036 PDB Deposition 03-SEP-23              PDB id: 1o5l

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1171
DESCRIPTIONTranscriptional regulator, CrP family.
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE CRP/FNR FAMILY OF TRANSCRIPTIONAL
REGULATORS.
DR UNIPROT; Q9X0Q3_THEMA
DR SPTR; Q9X0Q3 (flat text); Q9X0Q3 (good view)
DR GenBank; AAD36246
DR Pfam; PF00027; cNMP_binding;
DR Interpro; IPR000595; cNMP_binding;
DR Interpro; IPR001808; HTH_Crp;
DR PDB; 1O5L; Identical; 07-OCT-03; TRANSCRIPTIONAL REGULATOR, CRP FAMILY;
DR FFAS; 283036; Fold and function assignment.
DR TVPC; TM1171; Homologs in PDB, JCSG and SG center.
DR OVP; TM1171; Ortholog view popup.
DR TPM; TM1171; Target PDB monitor.
DR FSS; TM1171; Target function coverage.
PROPERTY Residues: 201 aa
Molecule Weight: 23393.3 Dalton
Isoelectric Point: 7.79
Extinction Coefficient: 1490
Gravy Index: -.15
Number of Met residues: 4
Percentage of Met residues: 1.99 %
Number of Cys residues: 2
Percentage of Cys residues: 1.00 %
SEQUENCE  amino acids 201 aa
>TM1171  TM1171 transcriptional regulator, crp family
MDLKKLLPCGKVIVFRKGEIVKHQDDPIEDVLILLEGTLKTEHVSENGKTLEIDEIKPVQ
IIASGFIFSSEPRFPVNVVAGENSKILSIPKEVFLDLLMKDRELLLFFLKDVSEHFRVVS
EKLFFLTTKTLREKLMNFLVRHMNEKRELTLPVTLEELSRLFGCARPALSRVFQELEREG
YIEKHGRRIKVLKNPFEHDRI

CDS  cDNA 603 bp
   1 gtggatctga aaaaactgct tccatgtgga aaagtgatcg tgttcagaaa aggtgaaatc    60
  61 gtgaaacacc aggatgatcc gatagaagat gtactcattc tcctggaagg aactctgaaa   120
 121 acagaacacg tctctgaaaa cggaaaaaca ctcgagatcg acgagataaa gcccgttcag   180
 181 atcattgcat ccggtttcat cttctccagt gaacccagat ttccggtgaa cgtggtggca   240
 241 ggagagaact caaagatcct ctcgataccg aaagaggttt ttctcgatct tctgatgaaa   300
 301 gacagagagc ttcttctttt ctttttgaag gacgtatcgg aacacttcag ggtagtttct   360
 361 gagaagctct ttttcctcac cacaaagacg ctcagagaaa agttgatgaa ctttctggtg   420
 421 cgtcacatga acgaaaagag agaattgaca ctccctgtca ccttagagga gctctccaga   480
 481 ctctttggct gtgccaggcc ggcgctttcg agggtctttc aggaactgga gagggaaggt   540
 541 tacatagaga agcatggaag gaggataaag gttctcaaaa atcctttcga acatgataga   600
 601 atc   603
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1187671 1188276 -1 Glimmer3 score 14.64 good
Genemark probabilities .85   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu