LOADING...
   TM1169;TM1169
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1169    TM1169            JCSG 283034 PDB Deposition 03-SEP-17              PDB id: 1o5i

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1169
DESCRIPTION3-oxoacyl-(acyl carrier protein) reductase.
ORGANISMThermotoga maritima
COMMENTVery important participant of Fatty Acid Biosynthesis(FASII).
-!- SIMILARITY: BELONGS TO THE SHORT-CHAIN DEHYDROGENASES/REDUCTASES
(SDR) FAMILY.
DR UNIPROT; Q9X0Q1_THEMA
DR SPTR; Q9X0Q1 (flat text); Q9X0Q1 (good view)
DR GenBank; AAD36244
DR Interpro; IPR002198; ADH_short;
DR PDB; 1O5I; Identical; 30-SEP-03; 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE;
DR PDB; 2Z1N; Highly similar; 18-MAR-08; DEHYDROGENASE;
DR PDB; 2P68; Highly similar; 17-APR-07; 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE;
DR PDB; 2PNF; Highly similar; 01-MAY-07; 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE;
DR PDB; 3F9I; Highly similar; 25-NOV-08; 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE;
DR PDB; 1I01; Highly similar; 07-FEB-01; BETA-KETOACYL [ACP] REDUCTASE;
DR PDB; 1Q7B; Highly similar; 17-FEB-04; 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;
DR PDB; 1Q7C; Highly similar; 17-FEB-04; 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE;
DR KEGG; 1.1.1.100; Enzyme page
DR FFAS; 283034; Fold and function assignment.
DR TVPC; TM1169; Homologs in PDB, JCSG and SG center.
DR OVP; TM1169; Ortholog view popup.
DR TPM; TM1169; Target PDB monitor.
DR FSS; TM1169; Target function coverage.
PROPERTY Residues: 237 aa
Molecule Weight: 26191.02 Dalton
Isoelectric Point: 6.05
Extinction Coefficient: 18450
Gravy Index: .03
Number of Met residues: 6
Percentage of Met residues: 2.53 %
Number of Cys residues: 4
Percentage of Cys residues: 1.69 %
SEQUENCE  amino acids 237 aa
>TM1169  TM1169 3-oxoacyl-(acyl carrier protein) reductase (fabG-1)
MELGIRDKGVLVLAASRGIGRAVADVLSQEGAEVTICARNEELLKRSGHRYVVCDLRKDL
DLLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGW
GRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVK
ELLSEEKKKQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGGLSKFPL

CDS  cDNA 711 bp
   1 ttggaactgg gcatcaggga taagggagta ctcgttcttg cggcgagcag gggtattgga    60
  61 agagctgtag cggatgtttt gagccaggaa ggagcggaag ttaccatctg tgcgagaaat   120
 121 gaagaacttt tgaagagaag cggccacaga tacgtcgtct gcgatctcag gaaggatctg   180
 181 gatctactgt tcgaaaaggt gaaagaggtg gacatcctcg ttctgaacgc aggaggacca   240
 241 aaagcgggat tcttcgatga acttacgaat gaagatttca aagaagcgat cgacagcctc   300
 301 tttttgaaca tgatcaaaat tgtgagaaac tatcttccag cgatgaaaga aaagggctgg   360
 361 ggaaggatcg tagccatcac ttctttctcc gtgatctcac cgatagaaaa tctctacaca   420
 421 tccaattctg cgaggatggc cctcaccgga tttctaaaga cactctcttt tgaggtggca   480
 481 ccgtacggta tcacagtgaa ctgtgtggca ccgggctgga cggagacaga gagggtgaaa   540
 541 gagcttctca gtgaagaaaa gaaaaaacag gtggaatctc agatccccat gagaaggatg   600
 601 gcaaaacccg aagagatagc cagtgttgtg gcatttctct gttccgaaaa ggcctcttat   660
 661 ctaactggac aaaccattgt tgtggatggt gggctttcca aatttccgct c   711
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1185112 1185825 -1 Glimmer3 score 13.25 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu