LOADING...
   TM1158;TM1158
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1158    TM1158            JCSG 283024 PDB Deposition 03-FEB-12              PDB id: 1o1y

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1158
DESCRIPTIONputative glutamine amido transferase [Flavodoxin-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0P2_THEMA
DR SPTR; P58009 (flat text); P58009 (good view)
DR GenBank; AE001773
DR Pfam; PF00117; GATase;
DR PDB; 1O1Y; Identical; 11-MAR-03; CONSERVED HYPOTHETICAL PROTEIN TM1158;
DR KEGG; 2.; Enzyme page
DR FFAS; 283024; Fold and function assignment.
DR TVPC; TM1158; Homologs in PDB, JCSG and SG center.
DR OVP; TM1158; Ortholog view popup.
DR TPM; TM1158; Target PDB monitor.
DR FSS; TM1158; Target function coverage.
PROPERTY Residues: 227 aa
Molecule Weight: 26898.77 Dalton
Isoelectric Point: 5.66
Extinction Coefficient: 38390
Gravy Index: -.45
Number of Met residues: 7
Percentage of Met residues: 3.08 %
Number of Cys residues: 1
Percentage of Cys residues: 0.44 %
SEQUENCE  amino acids 227 aa
>TM1158  TM1158 conserved hypothetical protein
MRVLAIRHVEIEDLGMMEDIFREKNWSFDYLDTPKGEKLERPLEEYSLVVLLGGYMGAYE
EEKYPFLKYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNGEEIGWYFVEKVS
DNKFFREFPDRLRVFQWHGDTFDLPRRATRVFTSEKYENQGFVYGKAVGLQFHIEVGART
MKRWIEAYKDELEKKKIDPRLLLETAEREEKVLKGLLRSLLERMVES

CDS  cDNA 681 bp
   1 gtgagagtgc tcgctattag acacgtcgag atagaggacc ttggaatgat ggaagatatc    60
  61 ttcagggaga agaactggag tttcgattat ctggacactc caaaagggga aaaactcgaa   120
 121 aggcctctcg aagagtattc tctcgtggtg cttcttggag ggtatatggg agcctacgag   180
 181 gaagagaaat accctttttt gaagtacgaa tttcagttga tagaagagat cctgaaaaaa   240
 241 gaaatcccgt tccttggaat atgtctgggt tctcagatgc tcgctaaagt ccttggggcg   300
 301 agtgtctaca gaggaaaaaa cggagaagaa ataggctggt attttgttga aaaggtctcc   360
 361 gacaataagt ttttcagaga atttccagac agactgcggg tgtttcagtg gcatggagat   420
 421 actttcgatc ttccacgcag agcaaccagg gtctttactt ctgaaaagta tgaaaaccag   480
 481 ggattcgtct atggcaaggc tgtggggctc cagttccata tagaagtggg agccagaacc   540
 541 atgaaacgct ggatagaggc atacaaagat gaacttgaaa aaaagaagat agatcccagg   600
 601 cttctccttg aaacggcgga gagggaggaa aaagtcctga aaggcctctt gaggtctctt   660
 661 ttggaaagga tggtggaaag c   681
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1171310 1171993 2 Glimmer3 score 12.02 good
Genemark probabilities .81   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu