LOADING...
   TM1154;TM1154
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1154    TM1154            JCSG 283020 PDB Deposition 04-JUN-30              PDB id: 1vl1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1154
DESCRIPTION6-phosphogluconolactonase (EC 3.1.1.31) (6PGL).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: HYDROLYSIS OF 6-PHOSPHOGLUCONOLACTONE TO 6-
PHOSPHOGLUCONATE.
-!- CATALYTIC ACTIVITY: 6-PHOSPHO-D-GLUCONO-1,5-LACTONE + H(2)O = 6-
PHOSPHO-D-GLUCONATE.
-!- PATHWAY: PENTOSE PHOSPHATE PATHWAY; SECOND STEP.
-!- SIMILARITY: BELONGS TO THE GLUCOSAMINE/GALACTOSAMINE-6-PHOSPHATE
ISOMERASE FAMILY. 6-PHOSPHOGLUCONOLACTONASE SUBFAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; 6PGL_THEMA
DR SPTR; Q9X0N8 (flat text); Q9X0N8 (good view)
DR GenBank; AAD36230
DR Interpro; IPR006148; Gluc_gal_isom;
DR Interpro; IPR005900; Phosphogluconlac;
DR PDB; 1VL1; Identical; 17-AUG-04; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 1PBT; Identical; 23-SEP-03; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3OC6; Highly similar; 18-AUG-10; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 2J0E; Highly similar; 03-JAN-07; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3EB9; Highly similar; 26-MAY-09; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3E7F; Highly similar; 26-MAY-09; 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3E15; Highly similar; 19-AUG-08; GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE;
DR KEGG; 3.1.1.31; Enzyme page
DR FFAS; 283020; Fold and function assignment.
DR TVPC; TM1154; Homologs in PDB, JCSG and SG center.
DR OVP; TM1154; Ortholog view popup.
DR TPM; TM1154; Target PDB monitor.
DR FSS; TM1154; Target function coverage.
PROPERTY Residues: 220 aa
Molecule Weight: 25323.86 Dalton
Isoelectric Point: 6.35
Extinction Coefficient: 22920
Gravy Index: -.3
Number of Met residues: 3
Percentage of Met residues: 1.36 %
Number of Cys residues: 1
Percentage of Cys residues: 0.45 %
SEQUENCE  amino acids 220 aa
>TM1154  TM1154 oxidoreductase, sol/devB family
MEKTVIYLLEDGYVDFVVEKIRTKMEKLLEEKDKIFVVLAGGRTPLPVYEKLAEQKFPWN
RIHFFLSDERYVPLDSDQSNFRNINEVLFSRAKIPSGNVHYVDTSLPIEKACEKYEREIR
SATDQFDLAILGMGPDGHVASIFDLETGNKDNLVTFTDPSGDPKVPRVTLTFRALNTSLY
VLFLIRGKEKINRLTEILKDTPLPAYFVRGKEKTVWFVGK

CDS  cDNA 660 bp
   1 atggagaaaa ctgtgatata cctgctcgaa gatgggtacg ttgattttgt agtcgagaaa    60
  61 attcgcacaa agatggaaaa acttctcgag gaaaaggata agatcttcgt cgttctcgcc   120
 121 ggcgggagaa ccccacttcc cgtttatgag aaactggcag aacagaagtt cccatggaat   180
 181 cgcatccact tctttttgag cgacgagcgg tacgtgcccc tcgactcaga tcaaagcaat   240
 241 ttcaggaaca taaacgaggt tcttttcagc agagcaaaga tcccttccgg taatgttcac   300
 301 tacgttgaca cttctcttcc tattgaaaaa gcctgcgaga aatatgagag ggaaataaga   360
 361 tcagctactg accagttcga cctcgctatt cttggaatgg gtcccgatgg ccatgtcgcg   420
 421 tccatattcg acttggaaac gggaaataaa gacaaccttg tgactttcac agatccttcc   480
 481 ggtgacccta aggttcccag agtcaccctg acgtttcgtg cactgaacac atcactgtac   540
 541 gtgctctttc tcatcagggg aaaagaaaag ataaacagac taacggagat cttaaaagat   600
 601 acaccacttc ccgcttactt cgtgagaggc aaagagaaaa ccgtctggtt tgtgggaaaa   660
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1167905 1168567 -2 Glimmer3 score 6.55 poor
Genemark probabilities .73   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu