LOADING...
   TM1135;TM1135
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1135    TM1135            JCSG 420134 PDB Deposition 11-AUG-10              PDB id: 3td9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1135
DESCRIPTIONLeucine specific ABC transporter, periplasmic binding protein LivK
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0L9_THEMA
DR SPTR; Q9X0L9 (flat text); Q9X0L9 (good view)
DR GenBank; AAD36211
DR Pfam; PF01094; ANF_receptor;
DR Interpro; IPR001828; ANF_receptor;
DR Interpro; IPR000709; Leu_Ile_Val_bind;
DR PDB; 3TD9; Identical; 07-SEP-11; BRANCHED CHAIN AMINO ACID ABC TRANSPORTER, PERIPL AMINO ACID;
DR PDB; 4N0Q; Highly similar; 06-NOV-13; LEU/ILE/VAL-BINDING PROTEIN HOMOLOG 3;
DR PDB; 3IPC; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR PDB; 3IP5; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR PDB; 3IP6; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR PDB; 3IP7; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR PDB; 3IP9; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR PDB; 3IPA; Highly similar; 14-JUL-10; ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN (AMINO CHAIN: A;
DR FFAS; 283001; Fold and function assignment.
DR TVPC; TM1135; Homologs in PDB, JCSG and SG center.
DR OVP; TM1135; Ortholog view popup.
DR TPM; TM1135; Target PDB monitor.
DR FSS; TM1135; Target function coverage.
PROPERTY Residues: 370 aa
Molecule Weight: 40127.93 Dalton
Isoelectric Point: 5.27
Extinction Coefficient: 21890
Gravy Index: .14
Number of Met residues: 7
Percentage of Met residues: 1.89 %
Number of Cys residues: 1
Percentage of Cys residues: 0.27 %
SEQUENCE  amino acids 370 aa
>TM1135  TM1135 branched chain amino acid ABC transporter, periplasmic amino acid-binding protein (livJ)
MRKVLVTVLLVLTVLSLFSAVKIAVILPMTGGISAFGRMVWEGIQIAHEEKPTVLGEEVE
LVLLDTRSEKTEAANAAARAIDKEKVLAIIGEVASAHSLAIAPIAEENKVPMVTPASTNP
LVTQGRKFVSRVCFIDPFQGAAMAVFAYKNLGAKRVVVFTDVEQDYSVGLSNFFINKFTE
LGGQVKRVFFRSGDQDFSAQLSVAMSFNPDAIYITGYYPEIALISRQARQLGFTGYILAG
DGADAPELIEIGGEAVEGLLFTTHYHPKAASNPVAKKFVEVYKEKYGKEPAALNALGYDA
YMVLLDAIERAGSFDREKIAEEIRKTRNFNGASGIINIDENGDAIKSVVVNIVKNGSVDF
EAVINPDDLK

CDS  cDNA 1110 bp
   1 atgaggaagg tactggtaac cgttcttctt gtattgacag ttttgagtct tttctccgct    60
  61 gttaagatcg ctgtgattct tccaatgacg ggtggcattt ccgcttttgg aaggatggtg   120
 121 tgggaaggga ttcagatcgc tcacgaagag aaacctacgg ttctgggaga agaggtagaa   180
 181 ctcgttctcc ttgacaccag aagtgagaaa acagaagcag cgaacgcagc agcaagagcc   240
 241 attgacaaag aaaaggtcct cgcaataatc ggtgaagtgg ccagtgcaca ttctctcgcc   300
 301 atagcaccta ttgcagaaga gaacaaagtt cctatggtga ctcctgcctc cacgaatcca   360
 361 ctcgtaacac agggaagaaa gttcgtctcc agggtttgtt tcatcgaccc gttccaggga   420
 421 gcagccatgg cagtattcgc ttacaaaaat ctgggtgcaa aaagagtggt tgtgttcaca   480
 481 gatgtcgagc aggactacag tgtcggactc tctaatttct tcataaacaa gttcactgaa   540
 541 ctcggaggac aggtgaagag ggtgttcttc agaagtggtg atcaggactt ttccgcacag   600
 601 ctttccgttg cgatgtcgtt caacccggat gcaatctaca taacagggta ctacccggag   660
 661 atcgccctca tttccagaca agcaagacag cttggattca ccggttacat tctggcaggt   720
 721 gacggtgcag acgcaccgga actcatagag atcggtggag aagcagtgga aggcctcctc   780
 781 ttcaccacac actaccatcc gaaggcagcc agcaaccctg ttgcaaagaa attcgttgaa   840
 841 gtgtacaagg agaaatacgg aaaagaacca gctgcgctca acgctctcgg atacgacgct   900
 901 tacatggtgc ttctcgacgc gatcgaaagg gcaggaagct ttgacaggga aaagatcgct   960
 961 gaagagatca gaaaaacgag aaacttcaac ggtgccagcg gtatcataaa catcgacgag  1020
1021 aacggagacg ctatcaaatc tgttgttgta aacatagtga agaacggttc cgttgacttt  1080
1081 gaggctgtca tcaatcctga tgacctcaag  1110
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1148070 1149182 3 Glimmer3 score 12.03 good
Genemark probabilities .91   .74 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu