LOADING...
   TM1131;TM1131
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1131    TM1131            JCSG 282997 PDB Deposition 04-OCT-08              PDB id: 1vp4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1131
DESCRIPTIONAminotransferase, putative.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0L5_THEMA
DR SPTR; Q9X0L5 (flat text); Q9X0L5 (good view)
DR GenBank; AAD36207
DR Pfam; PF00155; Aminotran_1_2;
DR Interpro; IPR004839; Aminotrans_I/II;
DR PDB; 1VP4; Identical; 26-OCT-04; AMINOTRANSFERASE, PUTATIVE;
DR PDB; 3AOV; Highly similar; 12-OCT-11; PUTATIVE UNCHARACTERIZED PROTEIN PH0207;
DR PDB; 3AOW; Highly similar; 12-OCT-11; PUTATIVE UNCHARACTERIZED PROTEIN PH0207;
DR PDB; 3ATH; Highly similar; 18-JAN-12; PUTATIVE UNCHARACTERIZED PROTEIN PH0207;
DR PDB; 3AV7; Highly similar; 07-MAR-12; PUTATIVE UNCHARACTERIZED PROTEIN PH0207;
DR PDB; 3WX9; Highly similar; 24-SEP-14; PUTATIVE UNCHARACTERIZED PROTEIN PH0207;
DR PDB; 1X0M; Highly similar; 12-APR-05; AMINOTRANSFERASE II HOMOLOGUE;
DR PDB; 1WST; Highly similar; 25-OCT-05; MULTIPLE SUBSTRATE AMINOTRANSFERASE;
DR KEGG; 2.6.; Enzyme page
DR FFAS; 282997; Fold and function assignment.
DR TVPC; TM1131; Homologs in PDB, JCSG and SG center.
DR OVP; TM1131; Ortholog view popup.
DR TPM; TM1131; Target PDB monitor.
DR FSS; TM1131; Target function coverage.
PROPERTY Residues: 413 aa
Molecule Weight: 47133.13 Dalton
Isoelectric Point: 5.6
Extinction Coefficient: 44810
Gravy Index: -.19
Number of Met residues: 8
Percentage of Met residues: 1.94 %
Number of Cys residues: 3
Percentage of Cys residues: 0.73 %
SEQUENCE  amino acids 413 aa
>TM1131  TM1131 aminotransferase, putative
MVVNLEGKISKIGQNMKSSIIREILKFAADKDAISFGGGVPDPETFPRKELAEIAKEIIE
KEYHYTLQYSTTEGDPVLKQQILKLLERMYGITGLDEDNLIFTVGSQQALDLIGKLFLDD
ESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDGMDLNVLERKLSEFDKNGKIKQVKFIY
VVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGGPERV
VLLNTFSKVLAPGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLEQ
LKPTIELYRRKRTVMLNALEEYFSDIPGVKWVKSEGGLFIWLTLPEGFDTWEMFEYAKRK
KVFYVPGRVFKVYDEPSPSMRLSFCLPPDEKIVEGIKRLREVVLEYGKEKHLL

CDS  cDNA 1239 bp
   1 gtggtcgtga atctagaagg caagatctca aagataggcc aaaacatgaa atcctccatc    60
  61 atcagggaaa ttctcaaatt tgccgcggac aaagacgcca tttctttcgg agggggagta   120
 121 cccgatcctg agactttccc gagaaaagaa ctcgcagaaa tcgcaaagga aatcatagaa   180
 181 aaagagtacc attacactct tcagtactcc acaacagaag gagatcccgt tcttaaacag   240
 241 caaattttga agcttctgga gaggatgtac ggcatcacag gactcgacga agacaatctg   300
 301 atattcaccg ttggatccca gcaggcgctg gatctcattg gaaagctctt cctcgacgat   360
 361 gagagttact gcgttctcga tgatcccgcg tacctcggag ccataaacgc gttcaggcag   420
 421 tatcttgcga acttcgttgt ggtcccgctc gaagacgacg gaatggatct caacgttctg   480
 481 gaaagaaagc tttctgaatt cgacaaaaac ggaaagataa aacaggtgaa gttcatctac   540
 541 gttgtttcaa atttccacaa cccagcggga gtcacaactt ctctggaaaa gagaaaagcg   600
 601 ctcgtcgaga tcgcagagaa gtacgacctc ttcatagtgg aagacgatcc ctacggtgct   660
 661 ttgaggtacg aaggagaaac tgtggatccc atcttcaaga taggtggacc agaaagagtg   720
 721 gttcttctca acacgttcag caaagtcctc gctccgggtc tcagaatagg aatggtggcg   780
 781 ggaagcaagg agttcatcag aaagatcgtt caggcgaagc agtcagcgga tctgtgcagt   840
 841 cccgctatca ctcatcgtct cgctgcccgt tatttggaga ggtacgatct tctcgagcag   900
 901 ttgaaaccca ccatcgaact ctacagaaga aagagaacgg tgatgctcaa cgctctcgaa   960
 961 gagtacttct ccgacatacc aggcgtgaaa tgggtgaaat cggaaggcgg tctcttcatc  1020
1021 tggctcaccc ttcctgaggg tttcgacacc tgggagatgt tcgagtacgc aaagagaaag  1080
1081 aaggtgtttt acgttcctgg aagggttttc aaagtgtacg acgagccgag tccctctatg  1140
1141 aggctttcct tctgtctgcc gccggatgaa aagatcgttg aagggatcaa aaggctcagg  1200
1201 gaagttgtcc tcgagtacgg caaggaaaaa caccttctg  1239
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1143191 1144432 -2 Glimmer3 score - -
Genemark probabilities .98   .97 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu