LOADING...
   TM1128;TM1128
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1128    TM1128            JCSG 282994 PDB Deposition 04-JUL-23              PDB id: 1vlg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1128
DESCRIPTIONFerritin.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0L2_THEMA
DR SPTR; Q9X0L2 (flat text); Q9X0L2 (good view)
DR GenBank; AAD36204
DR Pfam; PF00210; Ferritin;
DR Interpro; IPR001064; Crystallin;
DR Interpro; IPR008331; Ferritin_Dps;
DR PDB; 1VLG; Identical; 17-AUG-04; FERRITIN;
DR PDB; 1Z4A; Identical; 24-OCT-06; FERRITIN;
DR PDB; 2JD6; Highly similar; 27-FEB-07; FERRITIN HOMOLOG;
DR PDB; 2JD7; Highly similar; 27-FEB-07; FERRITIN HOMOLOG;
DR PDB; 2JD8; Highly similar; 27-FEB-07; FERRITIN HOMOLOG;
DR PDB; 2X17; Highly similar; 21-APR-10; PUTATIVE FERRITIN HOMOLOG;
DR PDB; 3KX9; Highly similar; 15-DEC-10; FERRITIN;
DR PDB; 1S3Q; Highly similar; 12-APR-05; FERRITIN;
DR FFAS; 282994; Fold and function assignment.
DR TVPC; TM1128; Homologs in PDB, JCSG and SG center.
DR OVP; TM1128; Ortholog view popup.
DR TPM; TM1128; Target PDB monitor.
DR FSS; TM1128; Target function coverage.
PROPERTY Residues: 164 aa
Molecule Weight: 19377.93 Dalton
Isoelectric Point: 4.84
Extinction Coefficient: 29910
Gravy Index: -.55
Number of Met residues: 6
Percentage of Met residues: 3.66 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 164 aa
>TM1128  TM1128 ferritin
MMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFY
EYIYERGGRVELEAIEKPPSNWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVS
FLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYLGQRE

CDS  cDNA 492 bp
   1 atgatggtta tctcagaaaa agtgagaaaa gcgctcaacg atcagttgaa cagggagatc    60
  61 tactcttcct atctctatct ttcgatggca acttacttcg acgctgaagg attcaagggt   120
 121 tttgcccact ggatgaaaaa gcaagcgcag gaagagctca ctcacgcgat gaagttctac   180
 181 gaatacatct acgaaagagg aggaagggtc gaactcgaag ccatagagaa gccaccttcg   240
 241 aattggaatg gaataaaaga cgcctttgaa gcggctctga aacacgaaga attcgtcacc   300
 301 cagtcgattt acaacatcct ggaactcgct tcggaagaga aagatcacgc caccgtgagt   360
 361 ttcctcaaat ggttcgttga cgagcaggtg gaagaagaag atcaagtgag agaaatcctc   420
 421 gatcttttag aaaaggcaaa tggtcagatg tctgtgatct tccagctaga caggtatctt   480
 481 ggacagagag ag   492
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1141110 1141604 3 Glimmer3 score - -
Genemark probabilities .86   .98 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu