LOADING...
   TM1112;TM1112
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1112    TM1112            JCSG 282978 PDB Deposition 08-OCT-28              PDB id: 1o5u, 2k9z

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1112
DESCRIPTIONNovel Thermotoga maritima protein from the DUF861 family and cupin fold.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0J6_THEMA
DR SPTR; Q9X0J6 (flat text); Q9X0J6 (good view)
DR GenBank; AAD36188
DR Pfam; PF05899; Cupin_3;
DR Interpro; IPR008579; DUF861;
DR PDB; 1O5U; Identical; 11-NOV-03; NOVEL THERMOTOGA MARITIMA ENZYME TM1112;
DR PDB; 1LKN; Identical; 24-JUN-03; HYPOTHETICAL PROTEIN TM1112;
DR PDB; 2K9Z; Identical; 25-NOV-08; UNCHARACTERIZED PROTEIN TM1112;
DR FFAS; 282978; Fold and function assignment.
DR TVPC; TM1112; Homologs in PDB, JCSG and SG center.
DR OVP; TM1112; Ortholog view popup.
DR TPM; TM1112; Target PDB monitor.
DR FSS; TM1112; Target function coverage.
PROPERTY Residues: 89 aa
Molecule Weight: 10756.93 Dalton
Isoelectric Point: 5.5
Extinction Coefficient: 29450
Gravy Index: -.76
Number of Met residues: 1
Percentage of Met residues: 1.12 %
Number of Cys residues: 2
Percentage of Cys residues: 2.25 %
SEQUENCE  amino acids 89 aa
>TM1112  TM1112 hypothetical protein
MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVI
EKGDLVTFPKGLRCRWKVLEPVRKHYNLF

CDS  cDNA 267 bp
   1 gtggaagtga agatagaaaa gcccacaccc gagaaactca aggaactcag cgttgagaaa    60
  61 tggcccatct gggaaaaaga ggtcagcgag ttcgattggt actacgatac gaacgagacc   120
 121 tgctacatac tggaaggcaa ggtggaagtc acaacagagg atggaaaaaa gtacgtcata   180
 181 gagaaaggtg atctcgtcac ctttccgaaa ggtttgaggt gcaggtggaa ggttttagag   240
 241 ccggtcagaa agcactacaa cctcttc   267
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1124871 1125140 -3 Glimmer3 score 13.49 good
Genemark probabilities .76   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu