LOADING...
   TM1102;TM1102
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1102    TM1102            JCSG 282968 PDB Deposition 02-SEP-13              PDB id: 1o0w

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1102
DESCRIPTIONRibonuclease III (EC 3.1.26.3) (RNase III).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: DIGESTS DOUBLE-STRANDED RNA. INVOLVED IN THE PROCESSING
OF RIBOSOMAL RNA PRECURSORS AND OF SOME MRNAS (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: ENDONUCLEOLYTIC CLEAVAGE TO 5'-
PHOSPHOMONOESTER.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: CONTAINS 1 DRBM (DOUBLE-STRANDED RNA-BINDING) DOMAIN.
-!- SIMILARITY: CONTAINS 1 RNASE III DOMAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; RNC_THEMA
DR SPTR; Q9X0I6 (flat text); Q9X0I6 (good view)
DR GenBank; AAD36178
DR Pfam; PF00636; Ribonuclease_3;
DR Pfam; PF00035; dsrm;
DR Interpro; IPR001159; DS_RBD;
DR Interpro; IPR000999; RNase_III;
DR PDB; 1O0W; Identical; 13-NOV-02; RIBONUCLEASE III;
DR PDB; 3N3W; Highly similar; 02-JUN-10; RIBONUCLEASE III;
DR PDB; 2A11; Highly similar; 05-JUL-05; RIBONUCLEASE III;
DR PDB; 1YYK; Highly similar; 22-NOV-05; RIBONUCLEASE III;
DR PDB; 1YYW; Highly similar; 22-NOV-05; RIBONUCLEASE III;
DR PDB; 2NUE; Highly similar; 20-NOV-07; 46-MER;
DR PDB; 2NUF; Highly similar; 20-NOV-07; 28-MER;
DR PDB; 2NUG; Highly similar; 20-NOV-07; 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3';
DR KEGG; 3.1.26.3; Enzyme page
DR FFAS; 282968; Fold and function assignment.
DR TVPC; TM1102; Homologs in PDB, JCSG and SG center.
DR OVP; TM1102; Ortholog view popup.
DR TPM; TM1102; Target PDB monitor.
DR FSS; TM1102; Target function coverage.
PROPERTY Residues: 240 aa
Molecule Weight: 27528.99 Dalton
Isoelectric Point: 5.2
Extinction Coefficient: 13410
Gravy Index: -.53
Number of Met residues: 5
Percentage of Met residues: 2.08 %
Number of Cys residues: 2
Percentage of Cys residues: 0.83 %
SEQUENCE  amino acids 240 aa
>TM1102  TM1102 ribonuclease III (rnc)
MNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAV
LELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRD
RDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEMLFDYKTALQEIVQSE
HKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLLKERS

CDS  cDNA 720 bp
   1 ttgaacgaga gtgagagaaa gatcgtggag gagtttcaga aagaaactgg aatcaacttc    60
  61 aagaacgaag aacttctctt tcgggctctg tgccacagtt cttacgcgaa cgagcaaaat   120
 121 caagcgggaa gaaaggacgt ggaatcgaac gaaaagctgg agtttctggg ggacgccgtt   180
 181 ctagaactct tcgtgtgcga aatactttac aaaaagtatc cggaagcgga agtgggagac   240
 241 ctggcccggg tgaaatccgc agcggcgagc gaagaagttc tcgccatggt ttccaggaag   300
 301 atgaatcttg gcaaattctt gtttcttgga aagggagagg aaaaaactgg tggacgtgat   360
 361 agagattcca tactcgccga cgcgttcgaa gcgcttctgg ctgccatata cctcgatcag   420
 421 ggctatgaga agataaagga gctatttgag caggaattcg agttctacat agaaaaaatc   480
 481 atgaagggtg aaatgctctt cgactacaaa acggctctcc aggaaatagt tcagagcgaa   540
 541 cacaaagtgc caccagaata tatactggtg agaacagaaa aaaacgatgg tgacaggatt   600
 601 tttgttgtgg aagtgagggt gaatgggaag accatcgcca caggcaaggg tagaacaaag   660
 661 aaagaagcgg aaaaggaggc cgcaagaatc gcctacgaaa agcttttgaa ggagagatca   720
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1118697 1119419 3 Glimmer3 score 14.32 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu