LOADING...
   TM1097;TM1097
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1097    TM1097            JCSG 282963 PDB Deposition 04-AUG-16              PDB id: 1vlv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1097
DESCRIPTIONOrnithine carbamoyltransferase (EC 2.1.3.3) (OTCase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: CARBAMOYL PHOSPHATE + L-ORNITHINE = PHOSPHATE
+ L-CITRULLINE.
-!- PATHWAY: ARGININE BIOSYNTHESIS; SIXTH STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE ATCASE/OTCASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; OTC_THEMA
DR SPTR; P96108 (flat text); P96108 (good view)
DR GenBank; CAA71670
DR Pfam; PF02729; OTCace_N;
DR Pfam; PF00185; OTCace;
DR Interpro; IPR006130; Asp/Orn_COtranf;
DR Interpro; IPR002292; Orn_carbamltrans;
DR Interpro; IPR006131; OTCace_O;
DR Interpro; IPR006132; OTCace_P;
DR PDB; 1VLV; Identical; 21-SEP-04; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 3UPD; Highly similar; 07-DEC-11; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 4H31; Highly similar; 26-SEP-12; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 4JFR; Highly similar; 13-MAR-13; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 4JHX; Highly similar; 20-MAR-13; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 4JQO; Highly similar; 17-APR-13; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 4KWT; Highly similar; 05-JUN-13; ORNITHINE CARBAMOYLTRANSFERASE;
DR PDB; 2W37; Highly similar; 17-NOV-09; ORNITHINE CARBAMOYLTRANSFERASE, CATABOLIC;
DR KEGG; 2.1.3.3; Enzyme page
DR FFAS; 282963; Fold and function assignment.
DR TVPC; TM1097; Homologs in PDB, JCSG and SG center.
DR OVP; TM1097; Ortholog view popup.
DR TPM; TM1097; Target PDB monitor.
DR FSS; TM1097; Target function coverage.
PROPERTY Residues: 313 aa
Molecule Weight: 35359.95 Dalton
Isoelectric Point: 5.62
Extinction Coefficient: 21430
Gravy Index: -.3
Number of Met residues: 17
Percentage of Met residues: 5.43 %
Number of Cys residues: 4
Percentage of Cys residues: 1.28 %
SEQUENCE  amino acids 313 aa
>TM1097  TM1097 ornithine carbamoyltransferase, anabolic (argF)
MSVNLKGRSLLTLLDFSPEEIRYLLDISKQVKMENRSKLRTERFKGMTLAMIFEKRSTRT
RLAFETAFAEEGGHPIFLSPNDIHLGAKESLEDTARVLGRMVDAIMFRGYKQETVEKLAE
YSGVPVYNGLTDEFHPTQALADLMTIEENFGRLKGVKVVFMGDTRNNVATSLMIACAKMG
MNFVACGPEELKPRSDVFKRCQEIVKETDGSVSFTSNLEEALAGADVVYTDVWASMGEED
KEKERMALLKPYQVNERVMEMTGKSETIFMHCLPAVKGQEVTYEVIEGKQSRVWDEAENR
KHTIKAVMIATLL

CDS  cDNA 939 bp
   1 gtgtctgtga atctgaaagg gagatctctt ctcactcttc ttgatttttc tcctgaagag    60
  61 atcagatacc ttctcgatat ctcaaagcag gtgaagatgg agaacagatc caaactgaga   120
 121 accgaaaggt tcaaaggaat gaccctcgcc atgatcttcg agaaacgatc aacgagaacg   180
 181 agactcgcct ttgaaaccgc ttttgcagaa gaaggaggac atccgatctt tctttcaccg   240
 241 aacgacatac accttggagc aaaagaatct ctcgaggaca ccgcacgcgt ccttggaaga   300
 301 atggtggacg ccatcatgtt caggggctac aaacaggaga ctgtggaaaa gctggctgag   360
 361 tactccggtg ttcccgtgta caacggactc accgacgagt tccacccaac gcaggcgctc   420
 421 gccgacctga tgaccataga ggaaaatttt ggcagattga agggtgtaaa ggttgttttc   480
 481 atgggggaca ccagaaacaa cgttgcgacc tccctcatga tcgcctgtgc gaagatgggg   540
 541 atgaatttcg tggcgtgtgg tcccgaagaa ctcaagccca gatctgacgt attcaaaagg   600
 601 tgccaagaaa tagtgaaaga aaccgatggg agcgtttctt tcacatcgaa tctggaagaa   660
 661 gcactcgcag gtgccgatgt cgtctacaca gacgtgtggg catccatggg tgaggaagac   720
 721 aaagaaaagg agagaatggc tcttttaaaa ccttatcagg tgaacgagag agtgatggaa   780
 781 atgacgggta aatcggaaac gattttcatg cactgcctcc ccgcggtgaa gggccaggag   840
 841 gtcacctacg aggtaatcga gggaaaacag agcagggtct gggacgaggc ggagaataga   900
 901 aagcacacca taaaagcggt catgatagca acactgctg   939
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1114933 1115874 1 Glimmer3 score 13.7 good
Genemark probabilities .87   .5 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu