LOADING...
   TM1088B;TM1088B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1088B    TM1088            JCSG 406264 PDB Deposition 09-SEP-20              PDB id: 3jxo

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1088B
DESCRIPTIONPutative transport protein, part of the K+ channel [TrkA C-terminal domain-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF02254; TrkA_N;
DR Pfam; PF02080; TrkA_C;
DR PDB; 3L4B; Identical; 16-FEB-10; TRKA K+ CHANNEL PROTIEN TM1088A;
DR PDB; 3JXO; Identical; 06-OCT-09; TRKA-N DOMAIN PROTEIN;
DR FFAS; 358958; Fold and function assignment.
DR TVPC; TM1088B; Homologs in PDB, JCSG and SG center.
DR OVP; TM1088B; Ortholog view popup.
DR TPM; TM1088B; Target PDB monitor.
DR FSS; TM1088B; Target function coverage.
PROPERTY Residues: 218 aa
Molecule Weight: 24035.8 Dalton
Isoelectric Point: 5.26
Extinction Coefficient: 5960
Gravy Index: .17
Number of Met residues: 5
Percentage of Met residues: 2.29 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 218 aa
>TM1088B  TM1088b
MKVIIIGGETTAYYLARSMLSRKYGVVIINKDRELCEEFAKKLKATIIHGDGSHKEILRD
AEVSKNDVVVILTPRDEVNLFIAQLVMKDFGVKRVVSLVNDPGNMEIFKKMGITTVLNLT
TLITNTVEALIFPDEFSSIIPLEQGIEFLSVNVEEDSPVVGKKLKDLPLPRDSIIAAIVR
GGVLVVPRGDTEILSGDKLYVIVSAEAKETVEETLLGR

CDS  cDNA 657 bp
   1 ttgaaagtca taataatcgg tggagaaacg acggcgtatt accttgcgcg ttccatgctg    60
  61 tcacgaaagt acggtgtagt gatcataaac aaagacaggg aactctgcga agagttcgcc   120
 121 aagaaattga aggcgacgat catacacgga gatggaagtc acaaagagat actcagagac   180
 181 gccgaggttt cgaaaaacga tgtggtggtg atcctcactc caagagatga ggtcaatttg   240
 241 ttcatcgcac agcttgttat gaaggacttc ggggtaaagc gggtagtgag tcttgtcaac   300
 301 gacccgggaa acatggaaat attcaaaaaa atgggtatca caaccgtctt gaatctcacc   360
 361 actctcataa cgaacacggt ggaagctctc atcttcccag atgagttctc cagcatcata   420
 421 ccgctggaac aaggtattga gtttctaagt gtgaacgtgg aagaagacag tccggttgtg   480
 481 ggaaagaagt tgaaggatct tccgcttcca agggatagta tcatcgctgc catcgtccgc   540
 541 ggtggagtgc ttgtggttcc gagaggagat acggagatcc tctccggtga taaactgtac   600
 601 gtgatcgtaa gtgcagaagc caaagaaaca gtcgaagaga cactgcttgg aaggtaa   657
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu