LOADING...
   TM1088A;TM1088A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1088A    TM1088A            JCSG 358957 PDB Deposition 06-FEB-14              PDB id: 2g1u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1088A
DESCRIPTIONPutative transport protein. N-terminal domain of TrkA protein from NAD(P)-binding Rossmann-domain fold. Possibily involved in potassium or calcium uptake.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF02254; TrkA_N;
DR PDB; 2G1U; Identical; 28-MAR-06; HYPOTHETICAL PROTEIN TM1088A;
DR PDB; 3L4B; Identical; 16-FEB-10; TRKA K+ CHANNEL PROTIEN TM1088A;
DR PDB; 1LSS; Highly similar; 03-JUL-02; TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG;
DR PDB; 4G65; Highly similar; 15-AUG-12; TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA;
DR PDB; 4J9U; Highly similar; 03-APR-13; TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKH;
DR PDB; 4J9V; Highly similar; 10-APR-13; POTASSIUM UPTAKE PROTEIN TRKA;
DR FFAS; 358957; Fold and function assignment.
DR TVPC; TM1088A; Homologs in PDB, JCSG and SG center.
DR OVP; TM1088A; Ortholog view popup.
DR TPM; TM1088A; Target PDB monitor.
DR FSS; TM1088A; Target function coverage.
PROPERTY Residues: 143 aa
Molecule Weight: 16032.54 Dalton
Isoelectric Point: 5.12
Extinction Coefficient: 5960
Gravy Index: -.02
Number of Met residues: 6
Percentage of Met residues: 4.20 %
Number of Cys residues: 3
Percentage of Cys residues: 2.10 %
SEQUENCE  amino acids 143 aa
>TM1088A  TM1088a
MSKKQKSKYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTVVGDAA
EFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVIARVYDPEKIKIFEENGI
KTICPAVLMIEKVKEFIIGSEED

CDS  cDNA 432 bp
   1 atgtcaaaaa aacaaaaaag caagtacatc gtgatattcg gctgtggaag acttggatcg    60
  61 ctgatagcaa atcttgcttc ctcttcggga cacagtgtcg tggtcgtgga taaaaacgaa   120
 121 tacgcgtttc acaggctcaa ctccgagttt tccggtttca ccgtggtggg agatgccgcg   180
 181 gagtttgaaa ctctgaaaga gtgtggtatg gagaaggcag acatggtgtt tgcgttcacg   240
 241 aacgacgaca gtacgaattt cttcatctcg atgaacgcaa ggtacatgtt caacgtggag   300
 301 aacgtgatcg ccagggtcta cgatccggaa aagataaaga ttttcgaaga aaatggaata   360
 361 aaaaccatct gtcccgccgt tctcatgata gagaaagtaa aggagttcat catagggagt   420
 421 gaagaagatt ga   432
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1103798 1104229 2 Glimmer3 score 14.58 good
Genemark probabilities .86   .63 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu