LOADING...
   TM1083;TM1083
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1083    TM1083            JCSG 282950 PDB Deposition 02-JUL-03              PDB id: 1j5u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1083
DESCRIPTIONArchease, possible chaperone from DUF101 group
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0H1_THEMA
DR SPTR; Q9X0H1 (flat text); Q9X0H1 (good view)
DR GenBank; AAD36160
DR Pfam; PF01951; Archease;
DR Interpro; IPR002804; DUF101;
DR PDB; 1J5U; Identical; 31-JUL-02; ARCHEASE, POSSIBLE CHAPERONE;
DR FFAS; 282950; Fold and function assignment.
DR TVPC; TM1083; Homologs in PDB, JCSG and SG center.
DR OVP; TM1083; Ortholog view popup.
DR TPM; TM1083; Target PDB monitor.
DR FSS; TM1083; Target function coverage.
PROPERTY Residues: 124 aa
Molecule Weight: 14664.9 Dalton
Isoelectric Point: 4.85
Extinction Coefficient: 22460
Gravy Index: -.69
Number of Met residues: 2
Percentage of Met residues: 1.61 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 124 aa
>TM1083  TM1083 conserved hypothetical protein
MRKPIEHTADIAYEISGNSYEELLEEARNILLEEEGIVLDTEEKEKMYPLEETEDAFFDT
VNDWILEISKGWAPWRIKREGNELKVTFRKIRKKEGTEIKALTYHLLKFERDGDVLKTKV
VFDT

CDS  cDNA 372 bp
   1 ttgaggaaac ccatagaaca taccgccgat atcgcttacg agatatccgg gaactcttac    60
  61 gaagaacttc tggaagaggc gagaaacatc cttctcgaag aagaagggat tgtcctcgac   120
 121 accgaagaga aagagaaaat gtatcctctt gaagagacgg aagacgcttt ttttgacacg   180
 181 gtgaacgact ggattcttga gatatcgaaa ggatgggctc cctggaggat taaaagggaa   240
 241 gggaatgagt taaaagtaac tttcaggaag atcagaaaaa aagagggaac cgaaataaaa   300
 301 gctctcacat accatcttct gaagttcgag cgtgatggag atgttctgaa aacgaaggtg   360
 361 gtgttcgata ct   372
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1097508 1097882 -3 Glimmer3 score 14.21 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu