LOADING...
   TM1080;TM1080
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1080    TM1080            JCSG 282947 PDB Deposition 03-FEB-12              PDB id: 1o1x

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1080
DESCRIPTIONRibose 5-phosphate isomerase RpiB(EC 5.3.1.6)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0G9_THEMA
DR SPTR; Q9X0G9 (flat text); Q9X0G9 (good view)
DR GenBank; AAD36157
DR Pfam; PF02502; LacAB_rpiB;
DR Interpro; IPR003500; Rib/Gal_isomrase;
DR PDB; 1O1X; Identical; 01-APR-03; RIBOSE-5-PHOSPHATE ISOMERASE RPIB;
DR PDB; 3HE8; Highly similar; 10-NOV-09; RIBOSE-5-PHOSPHATE ISOMERASE;
DR PDB; 3HEE; Highly similar; 10-NOV-09; RIBOSE-5-PHOSPHATE ISOMERASE;
DR PDB; 3PH4; Highly similar; 13-APR-11; RIBOSE-5-PHOSPHATE ISOMERASE;
DR PDB; 3PH3; Highly similar; 22-JUN-11; RIBOSE-5-PHOSPHATE ISOMERASE;
DR PDB; 1NN4; Highly similar; 29-JUL-03; RIBOSE 5-PHOSPHATE ISOMERASE B;
DR PDB; 2VVR; Highly similar; 08-JUL-08; RIBOSE-5-PHOSPHATE ISOMERASE B;
DR PDB; 3S5P; Highly similar; 01-JUN-11; RIBOSE 5-PHOSPHATE ISOMERASE;
DR KEGG; 5.3.1.6; Enzyme page
DR FFAS; 282947; Fold and function assignment.
DR TVPC; TM1080; Homologs in PDB, JCSG and SG center.
DR OVP; TM1080; Ortholog view popup.
DR TPM; TM1080; Target PDB monitor.
DR FSS; TM1080; Target function coverage.
PROPERTY Residues: 143 aa
Molecule Weight: 15866.34 Dalton
Isoelectric Point: 6.42
Extinction Coefficient: 12950
Gravy Index: -.07
Number of Met residues: 3
Percentage of Met residues: 2.10 %
Number of Cys residues: 2
Percentage of Cys residues: 1.40 %
SEQUENCE  amino acids 143 aa
>TM1080  TM1080 sugar-phosphate isomerase
MKIAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVDYPDYAKKVVQSILSNEADF
GILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAELAFWIV
DTFLSTPFDGGRHERRIRKIDEV

CDS  cDNA 429 bp
   1 gtgaagatcg ctattgcatc ggaccacgca gcttttgaac tgaaagagaa ggtgaagaac    60
  61 taccttctgg gcaagggaat agaagtggaa gatcacggta cctattccga ggaatccgtt   120
 121 gattatccgg actacgcaaa aaaagttgtt caatccattc tgtcgaacga agcggatttt   180
 181 ggaatccttt tgtgtgggac agggctcggg atgtcaattg ctgcaaacag gtacaggggc   240
 241 ataagagcag ctctctgtct tttcccggac atggcaagac tcgcgagatc gcacaacaat   300
 301 gcaaacatcc tcgttcttcc gggaaggctc atcggagcag agctcgcttt ctggatagtg   360
 361 gataccttcc tttcaacacc cttcgatgga ggaaggcacg aaaggagaat cagaaagatc   420
 421 gatgaggtt   429
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1096137 1096568 -3 Glimmer3 score 12.2 good
Genemark probabilities .88   .73 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu