LOADING...
   TM1056;TM1056
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1056    TM1056            JCSG 282923 PDB Deposition 03-SEP-19              PDB id: 1o5j

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1056
DESCRIPTIONPeriplasmic divalent cation tolerance protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; CUTA_THEMA
DR SPTR; Q9X0E6 (flat text); Q9X0E6 (good view)
DR GenBank; AAD36133
DR Pfam; PF03091; CutA1;
DR Interpro; IPR004323; CutA1;
DR PDB; 1KR4; Identical; 14-AUG-02; PROTEIN TM1056, CUTA;
DR PDB; 1O5J; Identical; 30-SEP-03; PERIPLASMIC DIVALENT CATION TOLERANCE PROTEIN;
DR PDB; 1VHF; Identical; 30-DEC-03; PERIPLASMIC DIVALENT CATION TOLERANCE PROTEIN;
DR PDB; 1UKU; Highly similar; 13-JAN-04; PERIPLASMIC DIVALENT CATION TOLERANCE PROTEIN CUTA;
DR PDB; 1UMJ; Highly similar; 05-OCT-04; PERIPLASMIC DIVALENT CATION TOLERANCE PROTEIN CUTA;
DR PDB; 4NYO; Highly similar; 01-JAN-14; DIVALENT-CATION TOLERANCE PROTEIN CUTA;
DR PDB; 4NYP; Highly similar; 01-JAN-14; DIVALENT-CATION TOLERANCE PROTEIN CUTA;
DR PDB; 1J2V; Highly similar; 13-JAN-04; 102AA LONG HYPOTHETICAL PERIPLASMIC DIVALENT CATION TOLERANC;
DR FFAS; 282923; Fold and function assignment.
DR TVPC; TM1056; Homologs in PDB, JCSG and SG center.
DR OVP; TM1056; Ortholog view popup.
DR TPM; TM1056; Target PDB monitor.
DR FSS; TM1056; Target function coverage.
PROPERTY Residues: 101 aa
Molecule Weight: 12176.5 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 29450
Gravy Index: -.41
Number of Met residues: 2
Percentage of Met residues: 1.98 %
Number of Cys residues: 1
Percentage of Cys residues: 0.99 %
SEQUENCE  amino acids 101 aa
>TM1056  TM1056 periplasmic divalent cation tolerance protein (cutA)
MILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEE
KEKELYEELRKLHPYETPAIFTLKVENVLTEYMNWLRESVL

CDS  cDNA 303 bp
   1 atgatactcg tgtattcgac ctttccaaat gaagaaaaag cgctcgagat aggaagaaaa    60
  61 ctcctcgaga aaaggctaat agcttgcttc aacgcgttcg aaatcagatc cggatactgg   120
 121 tggaaaggtg aaatcgttca agacaaagag tgggcggcta ttttcaagac tacagaagaa   180
 181 aaagaaaagg aactctacga agagttgaga aaacttcatc catacgaaac acccgcgatc   240
 241 ttcacactga aggtggaaaa cgtcctgact gaatacatga actggctcag agaatctgtt   300
 301 cta   303
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1069580 1069885 -2 Glimmer3 score 15.8 good
Genemark probabilities .84   .86 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu