LOADING...
   TM1050;TM1050
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1050    TM1050            JCSG 282917 PDB Deposition 09-AUG-27              PDB id: 3isx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1050
DESCRIPTIONEndoglucanase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0E0_THEMA
DR SPTR; Q9X0E0 (flat text); Q9X0E0 (good view)
DR GenBank; AAD36127
DR Pfam; PF05343; Peptidase_M42;
DR Interpro; IPR008007; Peptidase_M42;
DR PDB; 4P6Y; Identical; 08-APR-15; AMINOPEPTIDASE;
DR PDB; 3ISX; Identical; 08-SEP-09; ENDOGLUCANASE;
DR PDB; 1Y0R; Highly similar; 01-MAR-05; FRV OPERON PROTEIN FRVX;
DR PDB; 1Y0Y; Highly similar; 01-MAR-05; FRV OPERON PROTEIN FRVX;
DR PDB; 1XFO; Highly similar; 05-OCT-04; FRV OPERON PROTEIN FRVX;
DR PDB; 4WWV; Highly similar; 04-MAR-15; AMINOPEPTIDASE FROM FAMILY M42;
DR PDB; 2FVG; Highly similar; 07-MAR-06; ENDOGLUCANASE;
DR PDB; 1VHE; Highly similar; 30-DEC-03; AMINOPEPTIDASE/GLUCANASE HOMOLOG;
DR KEGG; 3.2.1.4; Enzyme page
DR FFAS; 282917; Fold and function assignment.
DR TVPC; TM1050; Homologs in PDB, JCSG and SG center.
DR OVP; TM1050; Ortholog view popup.
DR TPM; TM1050; Target PDB monitor.
DR FSS; TM1050; Target function coverage.
PROPERTY Residues: 331 aa
Molecule Weight: 36063.39 Dalton
Isoelectric Point: 5.15
Extinction Coefficient: 18910
Gravy Index: -.08
Number of Met residues: 9
Percentage of Met residues: 2.72 %
Number of Cys residues: 2
Percentage of Cys residues: 0.60 %
SEQUENCE  amino acids 331 aa
>TM1050  TM1050 endoglucanase
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVR
KLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
IPTRYVHSPSEMIAPDDVEATVDLLIRYLGA

CDS  cDNA 993 bp
   1 atgaaggaac tgatcagaaa gctgacggaa gccttcggcc caagtggacg ggaagaagag    60
  61 gtgagaagta tcatcctcga ggaactcgaa gggcacatag atggccacag gatcgatggg   120
 121 ctcggcaatc tcattgtctg gaaaggaagc ggcgagaaaa aggtgatact ggacgctcac   180
 181 atagatgaga taggtgttgt cgtcacaaac gtggacgaca agggatttct gacaatagaa   240
 241 cccgtcggcg gtgtctctcc gtacatgctt cttggaaaaa ggatcaggtt cgaaaacggt   300
 301 acaataggcg ttgttggtat ggaaggtgaa acaacagaag aaaggcagga gaatgtgaga   360
 361 aagctctcgt tcgacaagct gttcatcgat atcggtgcaa attccagaga agaagcacag   420
 421 aagatgtgcc caattggaag cttcggtgtc tacgacagtg gattcgtcga agtttccggg   480
 481 aaatacgtct cgaaggcgat ggatgacagg ataggatgtg ccgtgatcgt ggaagttttc   540
 541 aaaagaatca aacccgctgt tacgctctac ggtgttttca gtgttcagga agaagtggga   600
 601 ctggtcggtg cctcggtggc ggggtacggc gtaccagcgg acgaggccat cgcgatcgat   660
 661 gtgactgatt cggcagacac tccgaaggcc atcaagagac acgcaatgag gctctccggt   720
 721 ggacccgctc tgaaagtgaa agacagggca tcgatcagca gcaaacgcat cctcgaaaat   780
 781 ttgatagaaa tcgcggaaaa attcgatata aagtatcaga tggaggttct gacgttcggc   840
 841 ggtacgaacg ccatggggta ccagcggact agagaaggga ttccttcggc cacggtgtct   900
 901 attcccacac gatacgttca ctcacccagt gagatgatcg caccagatga tgttgaggca   960
 961 acggtcgatc ttctcatcag gtatctgggg gcg   993
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1065641 1066636 2 Glimmer3 score 13.23 good
Genemark probabilities .96   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu