LOADING...
   TM1049;TM1049
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1049    TM1049            JCSG 282916 PDB Deposition 06-JAN-30              PDB id: 2fvg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1049
DESCRIPTIONEndoglucanase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0D9_THEMA
DR SPTR; Q9X0D9 (flat text); Q9X0D9 (good view)
DR GenBank; AAD36126
DR Pfam; PF05343; Peptidase_M42;
DR Interpro; IPR008007; Peptidase_M42;
DR PDB; 2FVG; Identical; 07-MAR-06; ENDOGLUCANASE;
DR PDB; 4WWV; Highly similar; 04-MAR-15; AMINOPEPTIDASE FROM FAMILY M42;
DR PDB; 4P6Y; Highly similar; 08-APR-15; AMINOPEPTIDASE;
DR PDB; 3ISX; Highly similar; 08-SEP-09; ENDOGLUCANASE;
DR PDB; 1XFO; Highly similar; 05-OCT-04; FRV OPERON PROTEIN FRVX;
DR PDB; 1Y0R; Highly similar; 01-MAR-05; FRV OPERON PROTEIN FRVX;
DR PDB; 1Y0Y; Highly similar; 01-MAR-05; FRV OPERON PROTEIN FRVX;
DR PDB; 1VHE; Highly similar; 30-DEC-03; AMINOPEPTIDASE/GLUCANASE HOMOLOG;
DR FFAS; 282916; Fold and function assignment.
DR TVPC; TM1049; Homologs in PDB, JCSG and SG center.
DR OVP; TM1049; Ortholog view popup.
DR TPM; TM1049; Target PDB monitor.
DR FSS; TM1049; Target function coverage.
PROPERTY Residues: 339 aa
Molecule Weight: 37326.64 Dalton
Isoelectric Point: 6.05
Extinction Coefficient: 26360
Gravy Index: -.23
Number of Met residues: 5
Percentage of Met residues: 1.47 %
Number of Cys residues: 2
Percentage of Cys residues: 0.59 %
SEQUENCE  amino acids 339 aa
>TM1049  TM1049 endoglucanase
MYLKELSMMPGVSGDEGKVRDFIKSKIEGLVDNLYTDVLGNLIALKRGRDSSKKLLVSAH
MDEVGFVVSKIEKDGKVSFLPVGGVDPRILPGKVVQVKNLKGVIGYRPIHLQRDEENTPP
RFENLRIDFGFSSADEAKKYVSIGDYVSFVSDYIEKNGRAVGKAFDDRAGCSVLIDVLES
GVSPAYDTYFVFTVQEETGLRGSAVVVEQLKPTCAIVVETTTAGDNPELEERKWATHLGD
GPAITFYHRGYVIPKEIFQTIVDTAKNNDIPFQMKRRTAGGTDAGRYARTAYGVPAGVIS
TPARYIHSPNSIIDLNDYENTKKLIKVLVEEGKIVEVVS

CDS  cDNA 1017 bp
   1 atgtatctca aagagctttc gatgatgccg ggtgtgtctg gagatgaagg gaaggtcagg    60
  61 gatttcataa agtcaaagat agaaggtctt gttgacaacc tttacaccga tgtccttggg   120
 121 aatttgatag ctttgaaaag aggaagagat tcttcgaaaa aactgctcgt ttcggctcac   180
 181 atggatgagg tcggtttcgt tgtgagcaaa atagaaaagg acggaaaagt gtcgttcttg   240
 241 cccgttgggg gagtcgatcc caggatactt cccggaaagg tggttcaggt gaagaatctc   300
 301 aaaggagtta tcggctacag accgatccac cttcagcgcg atgaagagaa cactccccca   360
 361 aggtttgaga acctgagaat tgatttcggt ttttcttcgg cagacgaagc gaaaaagtac   420
 421 gtatcaatag gagactacgt ctctttcgtg agtgattaca tcgaaaagaa cggccgggca   480
 481 gtcgggaaag cgttcgacga cagagcgggt tgttctgttc tgatcgatgt tctcgaaagt   540
 541 ggtgtgagtc ccgcttacga cacgtacttt gtcttcacag ttcaagaaga gacgggtctt   600
 601 cgtggaagtg cagttgtggt ggaacagctg aaacccacct gtgccatcgt cgtggaaacc   660
 661 accacggccg gcgacaatcc ggaactggag gaaaggaaat gggcaacaca tctgggtgac   720
 721 ggtcctgcca tcacctttta ccacagagga tacgtgatcc caaaggagat ctttcagacc   780
 781 atcgtggata cggcgaagaa caacgacatt ccgtttcaga tgaagagaag aaccgctggg   840
 841 ggaacggacg cgggacgtta cgccagaacc gcctacggag taccagcagg tgtgatctcc   900
 901 actccagctc ggtacattca cagtccgaat tcgatcatag atttgaacga ctacgaaaac   960
 961 acgaagaaac tcataaaagt acttgtcgag gaaggaaaaa tcgtggaggt ggtctca  1017
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1064625 1065644 3 Glimmer3 score 14.17 good
Genemark probabilities .91   .94 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu