LOADING...
   TM1040;TM1040
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1040    TM1040            JCSG 359801 PDB Deposition 05-DEC-02              PDB id: 2f8j

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1040
DESCRIPTIONHistidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol- phosphate transferase).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: L-HISTIDINOL-PHOSPHATE + 2-OXOGLUTARATE = 3-
(IMIDAZOL-4-YL)-2-OXOPROPYL PHOSPHATE + L-GLUTAMATE.
-!- COFACTOR: PYRIDOXAL PHOSPHATE (BY SIMILARITY).
-!- PATHWAY: HISTIDINE BIOSYNTHESIS; SEVENTH STEP.
-!- SIMILARITY: BELONGS TO CLASS-II OF PYRIDOXAL-PHOSPHATE-DEPENDENT
AMINOTRANSFERASES. HISTIDINOL-PHOSPHATE AMINOTRANSFERASES
SUBFAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; HIS8_THEMA
DR SPTR; Q9X0D0 (flat text); Q9X0D0 (good view)
DR GenBank; AAD36117
DR Pfam; PF00155; Aminotran_1_2;
DR Interpro; IPR004839; Aminotrans_I/II;
DR Interpro; IPR005861; HisP_aminotrans;
DR Interpro; IPR001917; Aminotrans_II;
DR PDB; 1UU1; Identical; 18-MAR-04; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 1UU2; Identical; 18-MAR-04; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 1H1C; Identical; 19-MAR-04; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 1UU0; Identical; 13-MAY-04; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 2F8J; Identical; 21-FEB-06; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 3CQ4; Highly similar; 01-JUL-08; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 3CQ5; Highly similar; 01-JUL-08; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR PDB; 3CQ6; Highly similar; 01-JUL-08; HISTIDINOL-PHOSPHATE AMINOTRANSFERASE;
DR KEGG; 2.6.1.9; Enzyme page
DR FFAS; 282907; Fold and function assignment.
DR TVPC; TM1040; Homologs in PDB, JCSG and SG center.
DR OVP; TM1040; Ortholog view popup.
DR TPM; TM1040; Target PDB monitor.
DR FSS; TM1040; Target function coverage.
PROPERTY Residues: 335 aa
Molecule Weight: 39295.93 Dalton
Isoelectric Point: 5.38
Extinction Coefficient: 25330
Gravy Index: -.33
Number of Met residues: 9
Percentage of Met residues: 2.69 %
Number of Cys residues: 1
Percentage of Cys residues: 0.30 %
SEQUENCE  amino acids 335 aa
>TM1040  TM1040 histidinol-phosphate aminotransferase (hisC)
MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEE
LIEKILSYLDTDFLSKNNVSVGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKF
LEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTGAFVALDEAYYEFH
GESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF
AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHL
RTKNVAVRSFREGVRITIGKREENDMILRELEVFK

CDS  cDNA 1005 bp
   1 gtgaatcctc tcgatttgat tgcaaagagg gcgtatccgt acgaaaccga aaagagagac    60
  61 aaaacctacc ttgcgctgaa tgaaaatccg tttccctttc cagaggacct cgtggatgaa   120
 121 gtgtttcgac gattgaacag cgacgccctg aggatctact acgactcccc cgatgaagaa   180
 181 ttaatagaaa agatactctc atacctcgac accgattttc tttcgaaaaa caacgtctct   240
 241 gtgggaaacg gagcggatga gatcatctac gtgatgatgc tcatgttcga ccgttccgtt   300
 301 ttctttcccc cgacctacag ctgctacagg atctttgcga aggcagttgg agcgaaattc   360
 361 ctggaagtgc cgctcacgaa agatctgagg atacctgagg tgaacgtggg agaaggagac   420
 421 gttgttttca ttccgaaccc gaacaatcca acgggccatg tcttcgaaag agaggaaata   480
 481 gaaagaatcc tgaaaacggg tgccttcgtc gcgctggacg aagcctacta cgaattccac   540
 541 ggagaaagtt atgtggattt tctgaagaaa tacgaaaatc tcgctgtgat caggactttc   600
 601 tcgaaagcgt tttccctggc agcgcaacgt gtcggatacg ttgtggcctc ggagaagttc   660
 661 attgacgctt acaacagggt gagacttcct ttcaacgtga gctacgtctc ccagatgttc   720
 721 gcaaaggtag ctctcgatca cagagagatc tttgaagaaa gaacgaagtt catcgtggaa   780
 781 gaacgcgaga ggatgaagag tgctctcagg gaaatgggat accgaatcac cgactccaga   840
 841 ggaaacttcg tgttcgtatt catggagaag gaagaaaaag aaagacttct cgaacacctc   900
 901 cggacgaaga acgtcgctgt tcgcagtttc agggaaggtg ttagaatcac tatcggaaaa   960
 961 cgcgaagaga acgatatgat tctgagagaa ctggaggtgt tcaaa  1005
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1055425 1056432 -1 Glimmer3 score 15.07 good
Genemark probabilities .93   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu