LOADING...
   TM1036;TM1036
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1036    TM1036            JCSG 282903 PDB Deposition 05-JUN-16              PDB id: 2a0n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1036
DESCRIPTIONImidazole glycerol phosphate synthase subunit hisF (EC 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: IGPS CATALYZES THE CONVERSION OF PRFAR AND GLUTAMINE TO
IGP, AICAR AND GLUTAMATE. THE HISF SUBUNIT CATALYZES THE
CYCLIZATION ACTIVITY THAT PRODUCES IGP AND AICAR FROM PRFAR USING
THE AMMONIA PROVIDED BY THE HISH SUBUNIT.
-!- CATALYTIC ACTIVITY: 5-[(5-PHOSPHO-1-DEOXYRIBULOS-1-
YLAMINO)METHYLIDENEAMINO]-1-(5-PHOSPHORIBOSYL)IMIDAZOLE-4-
CARBOXAMIDE + L-GLUTAMINE = IMIDAZOLE-GLYCEROL PHOSPHATE + 5-
AMINOIMIDAZOL-4-CARBOXAMIDE RIBONUCLEOTIDE + L-GLUTAMATE + H(2)O.
-!- PATHWAY: HISTIDINE BIOSYNTHESIS; FIFTH STEP.
-!- SUBUNIT: HETERODIMER OF HISH AND HISF.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC.
-!- SIMILARITY: BELONGS TO THE HISA / HISF FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; HIS6_THEMA
DR SPTR; Q9X0C6 (flat text); Q9X0C6 (good view)
DR GenBank; AAD36113
DR Pfam; PF00977; His_biosynth;
DR Interpro; IPR003009; FMN_enzyme;
DR Interpro; IPR006062; His_biosynth;
DR Interpro; IPR004651; HisF;
DR PDB; 2WJZ; Identical; 25-AUG-10; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISF;
DR PDB; 3ZR4; Identical; 03-OCT-12; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HIS CHAIN: A,;
DR PDB; 2A0N; Identical; 19-JUL-05; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF;
DR PDB; 1THF; Identical; 14-JUL-00; HISF PROTEIN;
DR PDB; 1GPW; Identical; 10-FEB-02; HISF PROTEIN;
DR PDB; 2CK9; Identical; 29-MAY-07; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF;
DR PDB; 1VH7; Identical; 30-DEC-03; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF;
DR PDB; 4EWN; Identical; 05-DEC-12; IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HIS CHAIN: D;
DR KEGG; 4.1.3.; Enzyme page
DR FFAS; 282903; Fold and function assignment.
DR TVPC; TM1036; Homologs in PDB, JCSG and SG center.
DR OVP; TM1036; Ortholog view popup.
DR TPM; TM1036; Target PDB monitor.
DR FSS; TM1036; Target function coverage.
PROPERTY Residues: 253 aa
Molecule Weight: 27717.37 Dalton
Isoelectric Point: 5.19
Extinction Coefficient: 11460
Gravy Index: .04
Number of Met residues: 5
Percentage of Met residues: 1.98 %
Number of Cys residues: 1
Percentage of Cys residues: 0.40 %
SEQUENCE  amino acids 253 aa
>TM1036  TM1036 cyclase (hisF)
MLAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRK
TMLELVEKVAEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTF
GSQAVVVAIDAKRVDGEFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKS
GYDTEMIRFVRPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFHFREIDVRELKEY
LKKHGVNVRLEGL

CDS  cDNA 759 bp
   1 atgctcgcta aaagaataat cgcgtgtctc gatgtgaaag acggtcgtgt ggtgaaggga    60
  61 acgaacttcg aaaacctcag ggacagcggt gatcctgtcg aactgggaaa gttctattcc   120
 121 gaaattggaa tagacgaact cgtttttctg gatatcaccg cgtccgttga gaagaggaaa   180
 181 accatgctgg aactggtcga aaaggtggcc gagcagatcg acattccgtt cactgttgga   240
 241 ggaggtatcc acgacttcga aacggcctcg gagctcattc tccgtggtgc ggacaaggtg   300
 301 agcataaaca cggcggctgt ggagaatcct tctttgatca cacagatcgc tcaaactttt   360
 361 gggagtcagg ccgttgtcgt ggcgatagat gcaaaaagag tggatggaga gttcatggtc   420
 421 ttcacctact ccggaaagaa gaacacgggc atacttctga gagactgggt ggttgaagta   480
 481 gaaaagagag gagcaggaga gatcctgctc accagtatcg acagagacgg cacaaaatcg   540
 541 ggttacgata cggagatgat aaggttcgtg aggccactaa ccacacttcc catcatcgct   600
 601 tccggtggtg cgggaaaaat ggaacatttc cttgaagcct tcctggcagg tgccgacgct   660
 661 gcccttgcgg cttctgtctt tcacttcaga gagatcgacg tgagagaact gaaagagtac   720
 721 ctcaaaaaac acggagtgaa cgtgagactg gaggggttg   759
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1052784 1053545 -3 Glimmer3 score 15.35 good
Genemark probabilities .9   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu