LOADING...
   TM1030;TM1030
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1030    TM1030            JCSG 282897 PDB Deposition 05-MAY-02              PDB id: 1zkg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1030
DESCRIPTIONTranscriptional regulator, TETR family.
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL
REGULATORS.
DR UNIPROT; Q9X0C0_THEMA
DR SPTR; Q9X0C0 (flat text); Q9X0C0 (good view)
DR GenBank; AAD36107
DR Pfam; PF00440; TetR_N;
DR Interpro; IPR001647; HTH_TetR;
DR PDB; 1Z77; Identical; 10-MAY-05; TRANSCRIPTIONAL REGULATOR (TETR FAMILY);
DR PDB; 2IEK; Identical; 28-AUG-07; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 2ID6; Identical; 28-AUG-07; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 3IH2; Identical; 11-AUG-09; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 3IH3; Identical; 11-AUG-09; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 3IH4; Identical; 11-AUG-09; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 4I6Z; Identical; 02-JAN-13; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 4I76; Identical; 02-JAN-13; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR FFAS; 282897; Fold and function assignment.
DR TVPC; TM1030; Homologs in PDB, JCSG and SG center.
DR OVP; TM1030; Ortholog view popup.
DR TPM; TM1030; Target PDB monitor.
DR FSS; TM1030; Target function coverage.
PROPERTY Residues: 200 aa
Molecule Weight: 23799.48 Dalton
Isoelectric Point: 6.25
Extinction Coefficient: 22920
Gravy Index: -.41
Number of Met residues: 8
Percentage of Met residues: 4.00 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 200 aa
>TM1030  TM1030 transcriptional regulator, TetR family
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTE
KLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLD
LEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDM
NTLVEEVKVMLRILKKGMTK

CDS  cDNA 600 bp
   1 gtgttgtcga agagggatgc aatactgaag gcagcggttg aggttttcgg gaaaaaaggt    60
  61 tacgatcgag ccacaacaga cgaaatagca gagaaagccg gggtagccaa gggtttgatt   120
 121 tttcactatt tcaagaacaa agaagaactg tactatcagg catacatgtc cgttacagaa   180
 181 aagctccaga aggagttcga gaatttcctt atgaaaaaca ggaatagaga catatttgac   240
 241 ttcatggaac ggtggataga aaagaaactg gagtactccg cttctcatcc cgaagaagca   300
 301 gattttctga taacgctcgt gagcgtggat gaaggactca ggaaaagaat acttctcgac   360
 361 ctcgaaaaat cacagagggt cttttttgac ttcgtaaggg aaaaattgaa agatttagat   420
 421 ctcgcagaag atgtaacgga ggaaatcgct ctgaaatttc tgatgtggtt cttttccgga   480
 481 tttgaagaag tctacctgag gacctatcaa ggtaagcccg aactgctgaa aagagacatg   540
 541 aacacactcg ttgaagaagt gaaggtcatg ctcaggattt tgaagaaagg catgacaaaa   600
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1047908 1048510 2 Glimmer3 score - -
Genemark probabilities .88   .74 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu