LOADING...
   TM1012;TM1012
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1012    TM1012            JCSG 282879 PDB Deposition 05-DEC-12              PDB id: 2fcl, 2ewr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1012
DESCRIPTIONPutative nucleotidyltransferase [TM1012-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0A5_THEMA
DR SPTR; Q9X0A5 (flat text); Q9X0A5 (good view)
DR GenBank; AAD36089
DR PDB; 2EWR; Identical; 06-DEC-05; HYPOTHETICAL PROTEIN TM1012;
DR PDB; 4HX0; Identical; 11-SEP-13; PUTATIVE NUCLEOTIDYLTRANSFERASE TM1012;
DR PDB; 2FCL; Identical; 14-MAR-06; HYPOTHETICAL PROTEIN TM1012;
DR KEGG; 2.7.7-; Enzyme page
DR FFAS; 282879; Fold and function assignment.
DR TVPC; TM1012; Homologs in PDB, JCSG and SG center.
DR OVP; TM1012; Ortholog view popup.
DR TPM; TM1012; Target PDB monitor.
DR FSS; TM1012; Target function coverage.
PROPERTY Residues: 158 aa
Molecule Weight: 18625.54 Dalton
Isoelectric Point: 6.35
Extinction Coefficient: 26930
Gravy Index: -.49
Number of Met residues: 3
Percentage of Met residues: 1.90 %
Number of Cys residues: 1
Percentage of Cys residues: 0.63 %
SEQUENCE  amino acids 158 aa
>TM1012  TM1012 hypothetical protein
MIRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDIQTDEEGAYEIERIF
SEFVSKKVRFSSTEKICSHFGELIIDGIKVEIMGDIRKRLEDGTWEDPVDLNKYKRFVET
HGMKIPVLSLEYEYQAYLKLGRVEKAETLRKWLNERKG

CDS  cDNA 474 bp
   1 atgataaggc ccgaatatct tcgcgttctt cgtaaaatat acgaccgact gaaaaatgag    60
  61 aaagtgaact gggtagttac aggtagtctc agttttgcgc tgcagggagt tcctgttgaa   120
 121 gttcacgata tcgacattca aactgatgaa gaaggagctt atgaaatcga acgcattttc   180
 181 tctgagttcg taagcaaaaa ggtcaggttt tcttccacgg aaaaaatctg ttctcatttc   240
 241 ggtgaattaa ttatcgatgg aataaaagtt gaaattatgg gagatattcg aaaacggctc   300
 301 gaagatggaa cctgggaaga tcccgtagat ttgaacaaat acaaaaggtt tgtagaaaca   360
 361 catggaatga aaataccggt tttatccctg gagtatgaat atcaggcata tttgaaactg   420
 421 ggcagggtag agaaagccga gacgttgaga aagtggttaa acgaaaggaa gggg   474
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1028458 1028934 1 Glimmer3 score 6 poor
Genemark probabilities .51   .13 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu