LOADING...
   TM1010;TM1010
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1010    TM1010            JCSG 282877 PDB Deposition 05-NOV-23              PDB id: 2f4p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1010
DESCRIPTIONcupin-like protein [Double-stranded beta-helix]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X0A3_THEMA
DR SPTR; Q9X0A3 (flat text); Q9X0A3 (good view)
DR GenBank; AAD36075
DR Pfam; PF07883; Cupin_2;
DR Interpro; IPR007113; Cupin_sup;
DR PDB; 2F4P; Identical; 24-JAN-06; HYPOTHETICAL PROTEIN TM1010;
DR PDB; 4BIF; Highly similar; 11-SEP-13; CUPIN 2 CONSERVED BARREL DOMAIN PROTEIN;
DR PDB; 4UXA; Highly similar; 21-JAN-15; CUPIN 2 CONSERVED BARREL DOMAIN PROTEIN;
DR FFAS; 282877; Fold and function assignment.
DR TVPC; TM1010; Homologs in PDB, JCSG and SG center.
DR OVP; TM1010; Ortholog view popup.
DR TPM; TM1010; Target PDB monitor.
DR FSS; TM1010; Target function coverage.
PROPERTY Residues: 135 aa
Molecule Weight: 15051.23 Dalton
Isoelectric Point: 5.76
Extinction Coefficient: 26470
Gravy Index: -.44
Number of Met residues: 2
Percentage of Met residues: 1.48 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 135 aa
>TM1010  TM1010 hypothetical protein
MVDDIFERGSKGSSDFFTGNVWVKMLVTDENGVFNTQVYDVVFEPGARTHWHSHPGGQIL
IVTRGKGFYQERGKPARILKKGDVVEIPPNVVHWHGAAPDEELVHIGISTQVHLGPAEWL
GSVTEEEYRKATEGK

CDS  cDNA 405 bp
   1 atggtggatg atatctttga aaggggttct aaaggttcga gcgacttctt cactgggaac    60
  61 gtctgggtga agatgttggt tactgacgaa aacggggtat tcaacacaca ggtatacgac   120
 121 gtggtgttcg agccaggagc gagaacacac tggcacagcc atccgggagg gcagattctg   180
 181 atcgtgactc gcggaaaagg cttttaccag gaaagaggaa aacccgctag aattttgaaa   240
 241 aaaggtgatg tggtggagat accaccaaac gtggttcact ggcatggtgc ggcacccgat   300
 301 gaagaactcg tacatattgg tatcagtaca caggttcacc tcggtcctgc tgagtggctt   360
 361 ggatctgtta cagaagaaga gtatcggaaa gccacggaag gaaag   405
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1026799 1027206 1 Glimmer3 score 8.15 poor
Genemark probabilities .77   .39 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu