LOADING...
   TM1009;TM1009
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1009    TM1009            JCSG 282876 PDB Deposition 04-OCT-13              PDB id: 1vp5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1009
DESCRIPTION2,5-diketo-D-gluconic acid reductase (EC 1.1.1.274)
ORGANISMThermotoga maritima
COMMENT Belongs to very conservative aldo/keto reductase family.
Multiple external annotations of very close homologs from various sources (KEGG, PIR NREF Database, Genbank ) consistently point to
2,5-diketo-D-gluconic acid reductase function.
Genome and functional context supportive:
clustering on a chromosome with TM1006 - Aldo-keto reductase.
DR UNIPROT; Q9X0A2_THEMA
DR SPTR; Q9X0A2 (flat text); Q9X0A2 (good view)
DR GenBank; AAD36074
DR Pfam; PF00248; Aldo_ket_red;
DR Interpro; IPR001395; Aldo/ket_red;
DR PDB; 1VP5; Identical; 26-OCT-04; 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE;
DR PDB; 4MHB; Highly similar; 16-OCT-13; PUTATIVE ALDO/KETO REDUCTASE;
DR PDB; 1VBJ; Highly similar; 12-APR-05; PROSTAGLANDIN F SYNTHASE;
DR PDB; 3B3D; Highly similar; 21-OCT-08; PUTATIVE MORPHINE DEHYDROGENASE;
DR PDB; 3O0K; Highly similar; 11-AUG-10; ALDO/KETO REDUCTASE;
DR PDB; 3F7J; Highly similar; 25-NOV-08; YVGN PROTEIN;
DR PDB; 3D3F; Highly similar; 28-APR-09; YVGN PROTEIN;
DR PDB; 1MZR; Highly similar; 28-OCT-03; 2,5-DIKETO-D-GLUCONATE REDUCTASE A;
DR KEGG; 1.1.1.274; Enzyme page
DR FFAS; 282876; Fold and function assignment.
DR TVPC; TM1009; Homologs in PDB, JCSG and SG center.
DR OVP; TM1009; Ortholog view popup.
DR TPM; TM1009; Target PDB monitor.
DR FSS; TM1009; Target function coverage.
PROPERTY Residues: 286 aa
Molecule Weight: 33242.76 Dalton
Isoelectric Point: 5.97
Extinction Coefficient: 45380
Gravy Index: -.33
Number of Met residues: 10
Percentage of Met residues: 3.50 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %
SEQUENCE  amino acids 286 aa
>TM1009  TM1009 oxidoreductase, aldo/keto reductase family
MQVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAI
KRAIDEGIVRREELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHC
AWKAMEEMYKDGLVRAIGVSNFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRN
YNIQPEAWGPFAEGRKNIFQNGVLRSIAEKYGKTVAQVILRWLTQKGIVAIPKTVRRERM
KENISIFDFELTQEDMEKIATLDEGQSAFFSHRDPEVVKWICSLKR

CDS  cDNA 858 bp
   1 atgcaggttc caaaagttac tttgaacaac ggtgtagaaa tgcctattct gggatacgga    60
  61 gttttccaga taccaccaga aaagacggaa gaatgtgtct atgaggctat aaaggtggga   120
 121 tacagactca tcgacacagc agcatcgtac atgaacgaag agggagtggg aagagcgata   180
 181 aaacgcgcga ttgacgaagg aattgtcaga agagaggagc tcttcgtcac gaccaaactg   240
 241 tgggtgtcgg atgttggtta cgaatccaca aagaaggctt ttgaaaagtc tttgaagaaa   300
 301 ctgcaactcg aatacataga tctctatcta attcatcaac cttttggaga tgtacactgt   360
 361 gcctggaaag ctatggaaga aatgtacaaa gatggattgg taagagccat aggtgtgagc   420
 421 aacttctacc ctgatcggtt gatggatcta atggttcatc acgaaattgt tcccgcggtg   480
 481 aaccagatcg agatacatcc gttttatcag agacaagagg agatcgaatt catgagaaat   540
 541 tacaacatcc aacctgaagc ttggggtcct ttcgctgagg gaagaaaaaa cattttccag   600
 601 aacggagtgc tcagatcgat cgcggaaaag tacggcaaaa cggttgcaca ggtcattctg   660
 661 agatggctca ctcagaaagg aatcgttgcc attcccaaaa ctgtgagaag agagaggatg   720
 721 aaagaaaaca tcagcatctt cgattttgaa ctcacacagg aagacatgga aaagattgca   780
 781 acgctcgatg aagggcagag tgcgttcttc tcccacaggg atcccgaggt tgtcaagtgg   840
 841 atttgttcac tgaaaaga   858
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1025898 1026758 3 Glimmer3 score 12.47 good
Genemark probabilities .94   .72 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu