LOADING...
   TM0979;TM0979
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0979    TM0979            JCSG 282848 PDB Deposition 03-NOV-14              PDB id: 1rhx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0979
DESCRIPTIONPutative sulfur transferase
ORGANISMThermotoga maritima
COMMENTDsrH, a homolog of TM0979 is a part of a large operon in Chromatium vinosum containing a number of genes involved in sulfur oxidation dissimilatory pathway. Three tandem genes DsrE, DsrF and DsrH (structurally related to each other) form a cluster conserved in the same order in some proteobacteria (for example genes yheN, yheM and yheL in E.coli) and archaea (gene MTH1357,1358,1360 in M. thermoautotrophicum). Tentative implication of these protein in sirohaem assembly is compromised by their apparent absence in Archaeoglobus fulgidus, an organism that contains a dissimilatory siroheme sulfite reductase. In T.maritime only one of these three proteins seems to be present. Its genomic neighborhood consists of mostly hypothetical proteins without any indication of conserved clusters.
No indication of dissimilatory sulfite reductase (1.8.99.3) pathway or siroheme biosynthesis. Neither sulfite reductase nor siroheme synthase could be traced in T.maritima genome.
DR UNIPROT; Q9X074_THEMA
DR SPTR; Q9X074 (flat text); Q9X074 (good view)
DR GenBank; AAD36058
DR Pfam; PF04077; DsrH;
DR Interpro; IPR007215; DsrH;
DR PDB; 1X9A; Identical; 07-DEC-04; HYPOTHETICAL PROTEIN TM0979;
DR PDB; 1RHX; Identical; 21-DEC-04; CONSERVED HYPOTHETICAL PROTEIN TM0979;
DR FFAS; 282848; Fold and function assignment.
DR TVPC; TM0979; Homologs in PDB, JCSG and SG center.
DR OVP; TM0979; Ortholog view popup.
DR TPM; TM0979; Target PDB monitor.
DR FSS; TM0979; Target function coverage.
PROPERTY Residues: 87 aa
Molecule Weight: 9875.84 Dalton
Isoelectric Point: 4.71
Extinction Coefficient: 11460
Gravy Index: -.11
Number of Met residues: 1
Percentage of Met residues: 1.15 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 87 aa
>TM0979  TM0979 conserved hypothetical protein
MALVLVKYGTDHPVEKLKIRSAKAEDKIVLIQNGVFWALEELETPAKVYAIKDDFLARGY
SEEDSKVPLITYSEFIDLLEGEEKFIG

CDS  cDNA 261 bp
   1 atggcactcg tactcgttaa gtacggaacg gatcacccag tggaaaaact caaaataaga    60
  61 tctgcaaagg cagaagataa gatagttctc atacaaaacg gtgtcttctg ggctctggaa   120
 121 gaactcgaaa caccagcaaa ggtctacgca atcaaggacg attttcttgc gagaggatat   180
 181 tccgaagagg attcaaaagt tccactgatc acttacagtg aattcataga tcttctggag   240
 241 ggtgaagaga aattcatcgg c   261
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
991413 991676 -3 Glimmer3 score 13.45 good
Genemark probabilities .66   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu