LOADING...
   TM0961;TM0961
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0961    TM0961            JCSG 358514 PDB Deposition 05-OCT-27              PDB id: 2etd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0961
DESCRIPTIONLEMA protein [Bromodomain-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X056_THEMA
DR SPTR; Q9X056 (flat text); Q9X056 (good view)
DR GenBank; AAD36040
DR Pfam; PF04011; LemA;
DR Interpro; IPR007156; LemA;
DR PDB; 2ETD; Identical; 15-NOV-05; LEMA PROTEIN;
DR FFAS; 282830; Fold and function assignment.
DR TVPC; TM0961; Homologs in PDB, JCSG and SG center.
DR OVP; TM0961; Ortholog view popup.
DR TPM; TM0961; Target PDB monitor.
DR FSS; TM0961; Target function coverage.
PROPERTY Residues: 193 aa
Molecule Weight: 21633.81 Dalton
Isoelectric Point: 6.01
Extinction Coefficient: 13410
Gravy Index: -.16
Number of Met residues: 3
Percentage of Met residues: 1.55 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 193 aa
>TM0961  TM0961 lemA protein
MEGGIRVKRGLIVLIVILVLVVVIIGTTVGYYNYLVSLEQEVQEKYSQIQNQLQRRADLI
PNLVETVKGYAAHEKEILEEIANARAKLIGAKTPQESAQADAELSSALSRLLAIAENYPN
LKADANFRQLMDELAGTENRIAVARRDYNEAVKKYNTAIKKFPGVIFAKMFGFEEKQYFE
AKPGAEEVPEVKF

CDS  cDNA 579 bp
   1 atggaaggag ggatccgagt gaaaagaggt ctgatcgtac tgatagtgat actcgtactg    60
  61 gtagttgtca tcattggaac aactgtggga tactacaact accttgtttc ccttgagcag   120
 121 gaagttcagg aaaagtacag ccagatccag aatcaacttc aaagaagggc agatctcatt   180
 181 ccaaatctcg ttgaaactgt aaagggctac gccgcgcatg aaaaagagat actcgaagaa   240
 241 atagcgaacg ccagagcgaa gttgataggt gcgaaaactc ctcaggaaag tgctcaggcc   300
 301 gatgcagagc tttcttcggc cctttcgaga ctacttgcca tagccgagaa ctatccaaat   360
 361 ctgaaggcag acgcaaactt ccgacagctc atggatgagc tcgccggaac agagaacaga   420
 421 atcgccgttg caagaagaga ctacaacgaa gcggtgaaga aatacaacac cgctataaaa   480
 481 aaattccccg gtgtgatctt cgcgaagatg ttcggattcg aagaaaagca gtactttgaa   540
 541 gcgaaaccgg gagccgagga agttcccgag gtgaagttc   579
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
978331 978912 1 Glimmer3 score - -
Genemark probabilities .84   .46 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu