LOADING...
   TM0960;TM0960
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0960    TM0960            JCSG 282829 PDB Deposition 04-SEP-08              PDB id: 1vm7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0960
DESCRIPTIONRibokinase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X055_THEMA
DR SPTR; Q9X055 (flat text); Q9X055 (good view)
DR GenBank; AAD36039
DR Pfam; PF00294; PfkB;
DR Interpro; IPR002173; PfkB;
DR Interpro; IPR002139; Ribokinase;
DR PDB; 1VM7; Identical; 21-SEP-04; RIBOKINASE;
DR PDB; 4X8F; Highly similar; 21-JAN-15; RIBOKINASE;
DR PDB; 4XCK; Highly similar; 21-JAN-15; RIBOKINASE;
DR PDB; 4XDA; Highly similar; 04-MAR-15; RIBOKINASE;
DR PDB; 1RKD; Highly similar; 04-MAR-98; RIBOKINASE;
DR PDB; 1RKA; Highly similar; 31-AUG-99; PROTEIN (RIBOKINASE);
DR PDB; 1RKS; Highly similar; 31-AUG-99; PROTEIN (RIBOKINASE);
DR PDB; 1RK2; Highly similar; 01-SEP-99; RIBOKINASE;
DR FFAS; 282829; Fold and function assignment.
DR TVPC; TM0960; Homologs in PDB, JCSG and SG center.
DR OVP; TM0960; Ortholog view popup.
DR TPM; TM0960; Target PDB monitor.
DR FSS; TM0960; Target function coverage.
PROPERTY Residues: 299 aa
Molecule Weight: 32652.69 Dalton
Isoelectric Point: 4.96
Extinction Coefficient: 12950
Gravy Index: .01
Number of Met residues: 2
Percentage of Met residues: 0.67 %
Number of Cys residues: 3
Percentage of Cys residues: 1.00 %
SEQUENCE  amino acids 299 aa
>TM0960  TM0960 ribokinase (rbsK)
MFLVISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKIGEKGCRFV
TCIGNDDYSDLLIENYEKLGITGYIRVSLPTGRAFIEVDKTGQNRIIIFPGANAELKKEL
IDWNTLSESDILLLQNEIPFETTLECAKRFNGIVIFDPAPAQGINEEIFQYLDYLTPNEK
EIEALSKDFFGEFLTVEKAAEKFLELGVKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVD
TTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISVTRLGAQSSIPAREEVEAFLKNL

CDS  cDNA 897 bp
   1 atgtttctag tgatttccgt cgtggggagt tcaaacatag atatcgttct gaaggttgat    60
  61 cacttcacaa aacctggtga aacccagaaa gcgatagaga tgaacgtttt tccgggtgga   120
 121 aaaggggcga atcaggctgt aacagtcgca aaaattggag agaaaggatg ccgttttgta   180
 181 acgtgcattg gaaacgatga ttactctgat ctgctcatag agaattacga aaaactcgga   240
 241 ataactggat atataagagt tagtcttcct acaggaagag cgttcataga agtcgataaa   300
 301 acaggacaaa acaggatcat catctttcct ggagcgaacg ccgaactgaa aaaagaattg   360
 361 attgattgga atacgctctc tgaaagtgat atccttctcc ttcaaaacga aattcctttt   420
 421 gaaaccacct tggaatgtgc gaaaagattc aatggaattg tgatctttga ccccgcaccc   480
 481 gcgcagggaa taaacgaaga aatctttcag tacctggact atctcacacc gaatgaaaaa   540
 541 gagatcgaag ccctgtcgaa agatttcttc ggtgagtttt tgacggttga gaaagccgct   600
 601 gagaagtttc tggaactcgg cgtcaagaat gtgatagtga agctcggtga caaaggagta   660
 661 cttcttgtga acaaaaatga aaagaaacac tttccgacct tcaaagtaaa ggctgtggac   720
 721 acaacagcgg cgggggacgt gttcaatgga gcttttgccg ttgctctgtc tgagggaaaa   780
 781 aatcccgaag aggcggtaat ctttggaacg gcagcagcgg ccatatcggt aacaaggttg   840
 841 ggagctcaaa gttctattcc agcgagagaa gaagtagagg cgtttttgaa gaattta   897
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
977224 978123 -1 Glimmer3 score - -
Genemark probabilities .84   .59 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu