LOADING...
   TM0957;TM0957
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0957    TM0957            JCSG 358444 PDB Deposition 05-NOV-23              PDB id: 2f4i

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0957
DESCRIPTIONOB-fold protein
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X052_THEMA
DR SPTR; Q9X052 (flat text); Q9X052 (good view)
DR GenBank; AAD36036
DR PDB; 2F4I; Identical; 07-FEB-06; HYPOTHETICAL PROTEIN TM0957;
DR FFAS; 282826; Fold and function assignment.
DR TVPC; TM0957; Homologs in PDB, JCSG and SG center.
DR OVP; TM0957; Ortholog view popup.
DR TPM; TM0957; Target PDB monitor.
DR FSS; TM0957; Target function coverage.
PROPERTY Residues: 217 aa
Molecule Weight: 24714.64 Dalton
Isoelectric Point: 5.4
Extinction Coefficient: 17420
Gravy Index: .1
Number of Met residues: 6
Percentage of Met residues: 2.76 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 217 aa
>TM0957  TM0957 hypothetical protein
MKSKLTKRKVISMIVVFFILLLIYLSCDVIPIEEMEKGFDPKRYARELWFKLQDMMNEGL
GYDAVEVLNTLDENPELAHQKFAKVVGVSNYRYYIIQGVGEIVEIKDDGILVKVRENRKV
PDLFLSNHIFGNGIVNATGIAKMEDFDRIIDFNLTATELNKIVKEEVVNSFLKQLSKGAG
SVGSLVRFIAVFTLLKDEEIKYPIEAIPLYLEIQGGF

CDS  cDNA 651 bp
   1 ttgaaatcga agttaactaa aagaaaagtt atttccatga ttgttgtctt ctttatctta    60
  61 cttctgatct atctttcgtg tgatgtcatt cctatagaag aaatggagaa aggcttcgat   120
 121 cccaaaagat acgccagaga attatggttc aagctccaag acatgatgaa cgagggactt   180
 181 ggttatgatg cggtggaagt tttaaataca ttggacgaaa atcctgaact tgctcatcaa   240
 241 aagtttgcta aggtagttgg cgtttcaaat tacagatatt acatcataca gggtgtagga   300
 301 gaaattgttg aaataaaaga cgatggaata ctcgttaaag tcagagaaaa ccgcaaagtt   360
 361 ccagatttgt ttctaagtaa tcacattttt ggcaatggaa tagtcaacgc tactggtatt   420
 421 gcaaaaatgg aagattttga tagaatcatt gatttcaacc tcactgccac ggagctgaac   480
 481 aaaatagtga aagaagaggt ggtcaattct ttcttaaaac aactctcgaa aggagcaggc   540
 541 agcgtgggtt ctcttgttag attcatagcc gtttttactc tactcaaaga tgaagaaatt   600
 601 aagtatccaa tagaagcgat tccgctttat ctggaaattc agggaggttt t   651
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
975048 975701 -3 Glimmer3 score 6.64 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu