LOADING...
   TM0936;TM0936
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0936    TM0936            JCSG 282805 PDB Deposition 02-JUL-09              PDB id: 1j6p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0936
DESCRIPTIONMetal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family.
ORGANISMThermotoga maritima
COMMENTIn SEED: Cytosine deaminase, related metal-dependent hydrolases, chlorohydrolase.
In ERGO: chlorohydrolase/deaminase family protein(same).
Multiple external annotations of close homologs from various sources consistently point to metal-dependent hydrolase function.
DR UNIPROT; Q9X034_THEMA
DR SPTR; Q9X034 (flat text); Q9X034 (good view)
DR GenBank; AAD36017
DR Pfam; PF01979; Amidohydro_1;
DR Interpro; IPR006680; Amidohydro_1;
DR Interpro; IPR001064; Crystallin;
DR PDB; 1P1M; Identical; 29-APR-03; HYPOTHETICAL PROTEIN TM0936;
DR PDB; 2PLM; Identical; 17-JUL-07; UNCHARACTERIZED PROTEIN;
DR PDB; 1J6P; Identical; 30-OCT-02; METAL-DEPENDENT HYDROLASE OF CYTOSINEDEMANIASE/CHLOROHYDROLA;
DR PDB; 4F0R; Highly similar; 06-JUN-12; 5-METHYLTHIOADENOSINE/S-ADENOSYLHOMOCYSTEINE DEAM CHAIN: A;
DR PDB; 4F0S; Highly similar; 06-JUN-12; 5-METHYLTHIOADENOSINE/S-ADENOSYLHOMOCYSTEINE DEAM CHAIN: A;
DR PDB; 3LNP; Highly similar; 16-FEB-10; AMIDOHYDROLASE FAMILY PROTEIN OLEI01672_1_465;
DR PDB; 4DYK; Highly similar; 14-MAR-12; AMIDOHYDROLASE;
DR PDB; 4GBD; Highly similar; 12-JUN-13; PUTATIVE UNCHARACTERIZED PROTEIN;
DR FFAS; 282805; Fold and function assignment.
DR TVPC; TM0936; Homologs in PDB, JCSG and SG center.
DR OVP; TM0936; Ortholog view popup.
DR TPM; TM0936; Target PDB monitor.
DR FSS; TM0936; Target function coverage.
PROPERTY Residues: 406 aa
Molecule Weight: 45770.12 Dalton
Isoelectric Point: 5.15
Extinction Coefficient: 52370
Gravy Index: -.13
Number of Met residues: 15
Percentage of Met residues: 3.69 %
Number of Cys residues: 4
Percentage of Cys residues: 0.99 %
SEQUENCE  amino acids 406 aa
>TM0936  TM0936 conserved hypothetical protein
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPM
TLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEW
IAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSE
EYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVL
KDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQ
KAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHL
VHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELYSS

CDS  cDNA 1218 bp
   1 atgatcatag gaaattgcct gatactgaaa gatttctctt ctgaaccttt ctggggagcc    60
  61 gtagagatcg aaaacggcac gataaaacga gtgttacagg gagaagtgaa ggtcgatctg   120
 121 gatctctccg gcaaactcgt catgccggct cttttcaaca cgcacactca cgcgccgatg   180
 181 actcttctga gaggagtcgc ggaagatctc agtttcgaag agtggctctt ctctaaggtg   240
 241 cttcccatag aagacagatt gacagagaag atggcctact acggtacgat ccttgcccag   300
 301 atggaaatgg caagacatgg tatcgccggc tttgtcgata tgtactttca tgaggagtgg   360
 361 attgcaaagg cagtcagaga ttttggaatg agagccctct tgacacgggg acttgtggac   420
 421 agtaatgggg acgatggagg acgactcgag gagaatttga aactctacaa cgagtggaac   480
 481 ggttttgagg ggaggatttt cgttggattc ggtcctcact caccttacct ttgttctgaa   540
 541 gaatacctga agagagtctt cgacactgcg aagtctctga acgctccagt gacgattcat   600
 601 ctctatgaaa cctccaaaga agagtatgat ctggaggaca ttttgaacat cgggttgaaa   660
 661 gaagtgaaga ccatcgcagc tcattgtgtt catcttcccg agagatattt cggtgttctg   720
 721 aaagatattc cgtttttcgt ttctcacaat cctgcgagca atttgaaact cggaaacgga   780
 781 atagcacctg ttcagagaat gatagagcat gggatgaagg tcaccctcgg cacggatgga   840
 841 gcggcgagca acaactctct gaatctgttc ttcgaaatga ggctcgcgag tcttcttcag   900
 901 aaagcacaga atccgcgcaa tctggatgtg aacacatgct tgaaaatggt gacgtacgat   960
 961 ggagcccaag cgatggggtt caaaagcgga aagattgaag aaggctggaa cgccgatctt  1020
1021 gtggtaatag acctcgatct ccctgaaatg tttccagtcc agaacataaa gaaccacctc  1080
1081 gttcacgctt tcagcggtga agttttcgcc acgatggttg ctggaaagtg gatctacttc  1140
1141 gatggagagt acccgaccat agattcagaa gaagtgaaaa gagagctggc ccgtatagaa  1200
1201 aaagaactct actcttcc  1218
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
952699 953919 1 Glimmer3 score 12.26 good
Genemark probabilities .93   .34 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu