LOADING...
   TM0935;TM0935
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0935    TM0935            JCSG 282804 PDB Deposition 03-JUL-31              PDB id: 1o50

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0935
DESCRIPTIONCBS domain-containing protein [CBS-domain pair]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X033_THEMA
DR SPTR; Q9X033 (flat text); Q9X033 (good view)
DR GenBank; AAD36016
DR Pfam; PF00571; CBS;
DR Interpro; IPR000644; CBS_domain;
DR PDB; 1O50; Identical; 12-AUG-03; CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935;
DR KEGG; 2.; Enzyme page
DR FFAS; 282804; Fold and function assignment.
DR TVPC; TM0935; Homologs in PDB, JCSG and SG center.
DR OVP; TM0935; Ortholog view popup.
DR TPM; TM0935; Target PDB monitor.
DR FSS; TM0935; Target function coverage.
PROPERTY Residues: 145 aa
Molecule Weight: 16555.72 Dalton
Isoelectric Point: 5.13
Extinction Coefficient: 8480
Gravy Index: .02
Number of Met residues: 8
Percentage of Met residues: 5.52 %
Number of Cys residues: 1
Percentage of Cys residues: 0.69 %
SEQUENCE  amino acids 145 aa
>TM0935  TM0935 conserved hypothetical protein
MKVKDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYVARDNKLVGMIPVMHLLKVS
GFHFFGFIPKEELIRSSMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVV
DEKGEIVGDLNSLEILLALWKGREK

CDS  cDNA 435 bp
   1 atgaaagtga aagacgtctg caaattgatt tctctgaagc ccacagttgt agaggaagac    60
  61 actcctatag aagaaatcgt cgacaggata ctggaggatc ccgtcacaag aaccgtttat   120
 121 gttgcgagag acaacaaact cgttggaatg atccctgtca tgcacctttt gaaggtttct   180
 181 ggttttcact ttttcgggtt cattccaaag gaagagctca ttcgctcctc gatgaaaaga   240
 241 ttgatagcaa agaacgcatc tgagataatg ttggatcctg tatacgttca catggataca   300
 301 ccattggaag aagccttgaa gctgatgatc gacaacaata tacaggagat gccggttgtc   360
 361 gatgaaaagg gagagatagt gggagatctc aactctctcg aaattcttct cgctttgtgg   420
 421 aaagggcggg agaaa   435
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
952265 952702 2 Glimmer3 score 12.82 good
Genemark probabilities .83   .9 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu