LOADING...
   TM0922;TM0922
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0922    TM0922            JCSG 282791 PDB Deposition 05-SEP-02              PDB id: 2ax3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0922
DESCRIPTIONPutative carbohydrate kinase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X024_THEMA
DR SPTR; Q9X024 (flat text); Q9X024 (good view)
DR GenBank; AAD36003
DR Pfam; PF03853; YjeF_N;
DR Pfam; PF01256; Carb_kinase;
DR Interpro; IPR000631; UPF0031;
DR Interpro; IPR004443; YjeF_Nterm;
DR PDB; 2AX3; Identical; 04-OCT-05; HYPOTHETICAL PROTEIN TM0922;
DR PDB; 3RS8; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RS9; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RSF; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RSQ; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RSS; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RT7; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3RT9; Identical; 22-JUN-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR FFAS; 282791; Fold and function assignment.
DR TVPC; TM0922; Homologs in PDB, JCSG and SG center.
DR OVP; TM0922; Ortholog view popup.
DR TPM; TM0922; Target PDB monitor.
DR FSS; TM0922; Target function coverage.
PROPERTY Residues: 490 aa
Molecule Weight: 53001.37 Dalton
Isoelectric Point: 5.72
Extinction Coefficient: 17880
Gravy Index: .07
Number of Met residues: 7
Percentage of Met residues: 1.43 %
Number of Cys residues: 4
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 490 aa
>TM0922  TM0922 conserved hypothetical protein
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVA
RNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTG
LRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHI
LFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAG
SRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQ
ECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSP
AVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITG
NTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRL
IPEAIRRLKE

CDS  cDNA 1470 bp
   1 atgaaagaga tcgatgaatt aacaataaaa gaatacggtg tggactcgag aatcctcatg    60
  61 gagcgagccg gaatttccgt tgttctcgca atggaggagg aacttggaaa tctttctgat   120
 121 tacagattct tggttctctg cgggggagga aacaacggag gagacggctt tgtcgtggcc   180
 181 agaaatctcc tcggtgtggt aaaagatgtc ttggttgtct ttcttggaaa gaaaaaaact   240
 241 cccgattgtg agtataacta cggtctttac aaaaaattcg gaggaaaagt ggtggaacaa   300
 301 ttcgaaccct ctattctgaa cgaattcgat gtggtggttg acgccatttt tggaacgggc   360
 361 ctgagaggag aaatcacggg agagtacgct gagataataa atcttgtgaa taaatcgggg   420
 421 aaagtagttg tttccgttga cgttccatcg ggaatagatt cgaacacggg gaaggttctt   480
 481 agaacagcgg tgaaagcgga tctcacggtt acctttggag ttcccaagat aggtcacatc   540
 541 ctctttccag gaagagatct cacaggaaag ctcaaagtgg ccaacatagg ccatcctgtt   600
 601 catctgatca attcgatcaa tcgatacgtg ataacacggg aaatggttcg ttcccttctg   660
 661 ccggaaagac ccagagattc ccacaaggga acctacggaa aagtgctgat aatagcgggg   720
 721 tccagactgt actccggagc tcccgttctc tctggaatgg gatccttgaa agtgggaacg   780
 781 ggtcttgtga agctcgcagt tccttttcca cagaatctga tcgctacttc gagatttccg   840
 841 gaactcattt ccgttcccat agatacagaa aaaggcttct tcagcctgca gaatcttcag   900
 901 gaatgtctgg agctatcaaa agacgtggat gtggtagcca tcgggccggg tcttggaaac   960
 961 aatgaacacg tgagggagtt tgtcaacgag tttttgaaaa cactcgaaaa accggctgtc  1020
1021 atagacgccg atgccattaa cgttctggat acctcagttc tgaaggagag aaaatcccct  1080
1081 gcggtactaa ccccacatcc tggggagatg gcaagactcg tgaaaaaaac tgttggggac  1140
1141 gtcaagtaca actacgaact ggcagaggag tttgcaaaag aaaacgactg cgtgctggtt  1200
1201 ttgaaatctg ccaccaccat tgtaacagat ggcgagaaaa ccctgttcaa tataacggga  1260
1261 aacacaggac tttcaaaggg aggaagtgga gacgttctga caggaatgat agccggcttt  1320
1321 atagcacagg gactttcccc tctcgaagct tccacggttt ctgtgtatct acacggtttt  1380
1381 gccgcggagc ttttcgaaca ggatgagaga gggctcaccg cttccgagtt actgcgcctc  1440
1441 atacctgagg ctataaggag gttgaaagaa  1470
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
939882 941354 3 Glimmer3 score - -
Genemark probabilities .93   .65 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu