LOADING...
   TM0920;TM0920
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0920    TM0920            JCSG 375013 PDB Deposition 03-FEB-27              PDB id: 1o2d

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0920
DESCRIPTIONAlcohol dehydrogenase, iron-containing.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X022_THEMA
DR SPTR; Q9X022 (flat text); Q9X022 (good view)
DR GenBank; AAD36001
DR Pfam; PF00465; Fe-ADH;
DR Interpro; IPR001670; Fe-ADH;
DR PDB; 1O2D; Identical; 10-JUN-03; ALCOHOL DEHYDROGENASE, IRON-CONTAINING;
DR PDB; 1VHD; Identical; 30-DEC-03; ALCOHOL DEHYDROGENASE, IRON-CONTAINING;
DR PDB; 3BFJ; Highly similar; 25-NOV-08; 1,3-PROPANEDIOL OXIDOREDUCTASE;
DR PDB; 3ZDR; Highly similar; 02-OCT-13; ALCOHOL DEHYDROGENASE DOMAIN OF THE BIFUNCTIONAL ACETALDEHYD;
DR PDB; 2BI4; Highly similar; 06-JUL-05; LACTALDEHYDE REDUCTASE;
DR PDB; 2BL4; Highly similar; 06-JUL-05; LACTALDEHYDE REDUCTASE;
DR PDB; 1RRM; Highly similar; 17-AUG-04; LACTALDEHYDE REDUCTASE;
DR PDB; 3OWO; Highly similar; 16-FEB-11; ALCOHOL DEHYDROGENASE 2;
DR FFAS; 282789; Fold and function assignment.
DR TVPC; TM0920; Homologs in PDB, JCSG and SG center.
DR OVP; TM0920; Ortholog view popup.
DR TPM; TM0920; Target PDB monitor.
DR FSS; TM0920; Target function coverage.
PROPERTY Residues: 359 aa
Molecule Weight: 39940.89 Dalton
Isoelectric Point: 5.79
Extinction Coefficient: 34380
Gravy Index: -.25
Number of Met residues: 12
Percentage of Met residues: 3.34 %
Number of Cys residues: 2
Percentage of Cys residues: 0.56 %
SEQUENCE  amino acids 359 aa
>TM0920  TM0920 alcohol dehydrogenase, iron-containing
MWEFYMPTDVFFGEKILEKRGNIIDLLGKRALVVTGKSSSKKNGSLDDLKKLLDETEISY
EIFDEVEENPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFAKAVAVLLKEKDLSVEDLY
DREKVKHWLPVVEIPTTAGTGSEVTPYSILTDPEGNKRGCTLMFPVYAFLDPRYTYSMSD
ELTLSTGVDALSHAVEGYLSRKSTPPSDALAIEAMKIIHRNLPKAIEGNREARKKMFVAS
CLAGMVIAQTGTTLAHALGYPLTTEKGIKHGKATGMVLPFVMEVMKEEIPEKVDTVNHIF
GGSLLKFLKELGLYEKVAVSSEELEKWVEKGSRAKHLKNTPGTFTPEKIRNIYREALGV

CDS  cDNA 1077 bp
   1 gtgtgggaat tctacatgcc cacggatgtc ttttttggag aaaaaatcct cgagaagaga    60
  61 ggaaacataa tagatcttct tggaaaaaga gctttggtag taaccggcaa atcttcttcg   120
 121 aaaaagaacg gatctctcga tgatctgaaa aagcttctcg acgaaacaga aatatcctac   180
 181 gagatcttcg atgaagtcga ggagaatccg tctttcgaca acgttatgaa ggctgttgag   240
 241 agatacagaa acgattcttt cgatttcgtc gtgggactcg gtggaggaag ccctatggat   300
 301 ttcgccaagg cggtggccgt acttttgaaa gagaaagatc tttccgtcga agatctttac   360
 361 gatagagaaa aagtgaagca ctggcttcca gtcgtggaga taccaaccac cgctggaacg   420
 421 ggtagtgaag tcactccgta ttccatactc accgatccag agggaaacaa aagaggttgt   480
 481 acactcatgt ttccggtgta cgcgtttctc gatcccagat acacctactc catgtcagat   540
 541 gaactgacct tatcgactgg agtcgatgcg ctttctcatg cggtcgaagg atacctttct   600
 601 agaaagagta cgccgccttc cgatgccctc gcgatcgaag ccatgaagat aattcacagg   660
 661 aatttaccga aggccattga aggaaacaga gaagccagaa agaagatgtt cgtggcctcc   720
 721 tgccttgccg ggatggtgat tgcgcaaact gggaccacac tggcgcacgc tctgggttat   780
 781 cctctaacaa cggagaaggg aataaaacac gggaaagcga caggtatggt actaccattt   840
 841 gtaatggagg taatgaaaga agaaattcca gaaaaggtgg atactgtgaa tcacatattc   900
 901 ggcggcagtc ttttgaaatt tctgaaagaa ctcggacttt acgaaaaagt ggcagtttcc   960
 961 tctgaagaac tggagaagtg ggtcgaaaag ggttccagag cgaaacatct caaaaacacg  1020
1021 ccgggtacct tcactcccga aaagatcaga aacatataca gggaggcact cggggtg  1077
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
938313 939392 3 Glimmer3 score 14.21 good
Genemark probabilities .91   .94 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu