LOADING...
   TM0919;TM0919
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0919    TM0919            JCSG 282788 PDB Deposition 04-JUL-15              PDB id: 1vla

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0919
DESCRIPTIONHydroperoxide resistance protein OsmC
ORGANISMThermotoga maritima
COMMENTTM0919 (hydroperoxide resistance protein OsmC).
----------------------------------------------------------------------
JCSG annotation is produced by The Joint Center for Structural Genomics.
Swiss-prot annotation:
Hypothetical protein TM0919.
----------------------------------------------------------------------
DR UNIPROT; Q9X021_THEMA
DR SPTR; Q9X021 (flat text); Q9X021 (good view)
DR GenBank; AAD36000
DR Pfam; PF02566; OsmC;
DR Interpro; IPR003718; OsmC;
DR PDB; 1VLA; Identical; 17-AUG-04; HYDROPEROXIDE RESISTANCE PROTEIN OSMC;
DR PDB; 1ML8; Highly similar; 22-APR-03; HYPOTHETICAL PROTEIN (CRP REGION);
DR PDB; 2EGT; Highly similar; 04-SEP-07; HYPOTHETICAL PROTEIN AQ_1549;
DR PDB; 2E8C; Highly similar; 22-JAN-08; HYPOTHETICAL PROTEIN AQ_1549;
DR PDB; 2E8E; Highly similar; 22-JAN-08; HYPOTHETICAL PROTEIN AQ_1549;
DR PDB; 2E8F; Highly similar; 22-JAN-08; HYPOTHETICAL PROTEIN AQ_1549;
DR FFAS; 282788; Fold and function assignment.
DR TVPC; TM0919; Homologs in PDB, JCSG and SG center.
DR OVP; TM0919; Ortholog view popup.
DR TPM; TM0919; Target PDB monitor.
DR FSS; TM0919; Target function coverage.
PROPERTY Residues: 138 aa
Molecule Weight: 16002.84 Dalton
Isoelectric Point: 6.43
Extinction Coefficient: 12950
Gravy Index: -.41
Number of Met residues: 8
Percentage of Met residues: 5.80 %
Number of Cys residues: 3
Percentage of Cys residues: 2.17 %
SEQUENCE  amino acids 138 aa
>TM0919  TM0919 conserved hypothetical protein
MQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRK
MKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSV
SAILKCSSKVTYEIVYEN

CDS  cDNA 414 bp
   1 atgcaggcac gctggatagg aaacatgatg tttcatgtaa gaactgactc aaatcatgac    60
  61 gttctcatgg atacaaaaga agaggtcggg ggaaaagacg ctgctccccg acctcttgag   120
 121 ctcgtcctca ctgggctcat gggatgtaca ggaatggatg tggtctcaat tttgagaaaa   180
 181 atgaaagtga ttgatcagat gaaagacttc aggatagaga tcgagtacga acgcacggaa   240
 241 gaacatcccc gcatattcac taaagttcat ctgaagtaca tcttcaagtt cgatggggag   300
 301 cctccgaagg acaaggttga aaaagccgtt cagctttctc aggaaaaata ttgcagtgtc   360
 361 tctgccattt tgaagtgctc ttcgaaggtg acttacgaga ttgtttacga gaat   414
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
937886 938302 2 Glimmer3 score 7.31 poor
Genemark probabilities .75   .35 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu