LOADING...
   TM0915;TM0915
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0915    TM0915            JCSG 282784 PDB Deposition 05-OCT-27              PDB id: 2etj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0915
DESCRIPTIONRibonuclease HII (EC 3.1.26.4) (RNase HII).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: THIS ENZYME IS AN ENDONUCLEASE THAT DEGRADES THE RNA OF
RNA-DNA HYBRIDS SPECIFICALLY (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: ENDONUCLEOLYTIC CLEAVAGE TO 5'-
PHOSPHOMONOESTER.
-!- COFACTOR: MANGANESE (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE RNASE HII FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; RNH2_THEMA
DR SPTR; Q9X017 (flat text); Q9X017 (good view)
DR GenBank; AAD35996
DR Pfam; PF01351; RNase_HII;
DR Interpro; IPR001352; RNase_HII/HIII;
DR PDB; 2ETJ; Identical; 08-NOV-05; RIBONUCLEASE HII;
DR PDB; 4HHT; Identical; 06-FEB-13; RIBONUCLEASE HII;
DR PDB; 3O3G; Identical; 08-DEC-10; RIBONUCLEASE HII;
DR PDB; 3O3F; Identical; 08-DEC-10; RIBONUCLEASE HII;
DR PDB; 3O3H; Identical; 08-DEC-10; RIBONUCLEASE HII;
DR PDB; 1LJC; Highly similar; 15-MAY-02; RIBONUCLEASE HII;
DR PDB; 1UAX; Highly similar; 29-JUN-04; RIBONUCLEASE HII;
DR PDB; 1I39; Highly similar; 11-APR-01; RIBONUCLEASE HII;
DR KEGG; 3.1.26.4; Enzyme page
DR FFAS; 282784; Fold and function assignment.
DR TVPC; TM0915; Homologs in PDB, JCSG and SG center.
DR OVP; TM0915; Ortholog view popup.
DR TPM; TM0915; Target PDB monitor.
DR FSS; TM0915; Target function coverage.
PROPERTY Residues: 238 aa
Molecule Weight: 26628.53 Dalton
Isoelectric Point: 8.43
Extinction Coefficient: 5960
Gravy Index: -.13
Number of Met residues: 5
Percentage of Met residues: 2.10 %
Number of Cys residues: 2
Percentage of Cys residues: 0.84 %
SEQUENCE  amino acids 238 aa
>TM0915  TM0915 ribonuclease HII (rnhB)
MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDE
IMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCL
VKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPI
HRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKERTNHNLPLF

CDS  cDNA 714 bp
   1 atgggaatag atgagcttta caaaaaagag tttggaatcg tagcaggtgt ggatgaagcg    60
  61 ggaagagggt gcctcgcagg tcccgttgtg gcggccgctg tcgttctgga aaaagaaata   120
 121 gaaggaataa acgattcaaa acagctttcc cctgcgaaga gggaaagact tttagatgaa   180
 181 ataatggaga aggcagcagt tgggatagga attgcgtctc cagaggaaat agatctctac   240
 241 aacatattca atgccacaaa acttgctatg aatcgagcac tggagaacct gtctgtgaaa   300
 301 ccatcatttg tactcgttga cgggaaagga atcgagttga gcgttcccgg tacatgctta   360
 361 gtgaagggag accagaaaag caaattgata ggagcagctt ccattgttgc gaaggtcttc   420
 421 agagatagat tgatgagcga gtttcacagg atgtatccac agttttcctt ccacaaacac   480
 481 aaaggttacg ccacaaaaga acatctgaac gaaatcagaa agaacggagt tttaccaatc   540
 541 caccggctga gttttgaacc tgttttagaa cttctgaccg atgatttgtt gagggagttc   600
 601 ttcgaaaaag gcctcatctc cgaaaatcga ttcgaacgaa tattgaatct tctgggggcg   660
 661 agaaaaagtg tggttttccg gaaagaaaga acaaaccata atctccctct tttt   714
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
933029 933745 -2 Glimmer3 score 11.92 poor
Genemark probabilities .84   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu