LOADING...
   TM0894;TM0894
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0894    TM0894            JCSG 359759 PDB Deposition 05-MAY-26              PDB id: 1ztc

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0894
DESCRIPTIONputative metallo-beta-lactamase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZZ6_THEMA
DR SPTR; Q9WZZ6 (flat text); Q9WZZ6 (good view)
DR GenBank; AAD35975
DR Pfam; PF00753; Lactamase_B;
DR Interpro; IPR001279; Blactmase-like;
DR PDB; 1ZTC; Identical; 28-JUN-05; HYPOTHETICAL PROTEIN TM0894;
DR FFAS; 282763; Fold and function assignment.
DR TVPC; TM0894; Homologs in PDB, JCSG and SG center.
DR OVP; TM0894; Ortholog view popup.
DR TPM; TM0894; Target PDB monitor.
DR FSS; TM0894; Target function coverage.
PROPERTY Residues: 209 aa
Molecule Weight: 23944.27 Dalton
Isoelectric Point: 6.19
Extinction Coefficient: 22920
Gravy Index: -.11
Number of Met residues: 2
Percentage of Met residues: 0.96 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 209 aa
>TM0894  TM0894 conserved hypothetical protein
MELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPD
DITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVL
LKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSV
QVKNFLDRVGRIDLLVFPHDAPLKPEVKK

CDS  cDNA 627 bp
   1 gtggagttga aaatcctcgt aacgggagga aacgttttcg ttccaggaag gctgaacgct    60
  61 cacttctcca ctgtcgttta tctggaacac aaggacagaa gaatcatcat cgaccccggt   120
 121 aacctctctt ctatggacga actggaagaa aagttctctg agctaggaat ctccccggat   180
 181 gatataacgg acgttctctt cacgcatgtg catctcgatc atatcttcaa ctctgtcctc   240
 241 ttcgagaatg ctactttcta tgttcatgaa gtttacaaaa cgaagaacta tctttctttt   300
 301 ggtacgatcg tgggaagaat ctattcaaaa gtgatctctt cgtggaagaa tgtggtgctt   360
 361 ctgaagggag aagagtcgct gttcgatgaa aaagtaaagg tgtttcacac tccatggcac   420
 421 gccagagagc acctttcttt tcttctcgat acggagaatg cgggaagagt gctgatcacg   480
 481 ggggatataa cacctaacag gcttagctac tatgatataa tcaaagggta cggaagtgtt   540
 541 caggttaaga acttccttga cagagttgga aggatcgatc ttttagtttt tccacacgac   600
 601 gcaccgctga aaccggaggt gaaaaaa   627
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
916353 916982 3 Glimmer3 score 10.03 poor
Genemark probabilities .82   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu