LOADING...
   TM0892;TM0892
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0892    TM0892            JCSG 282761 PDB Deposition 05-FEB-17              PDB id: 1vr9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0892
DESCRIPTIONCBS domain protein/ACT domain protein [CBS-domain pair]
ORGANISMThermotoga maritima
COMMENTGenome context:
clustering on a chromosome with
TM0896 - Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10)and
TM0895 - Glycogen synthase (EC 2.4.1.21)
DR UNIPROT; Q9WZZ4_THEMA
DR SPTR; Q9WZZ4 (flat text); Q9WZZ4 (good view)
DR GenBank; AAD35973
DR Pfam; PF00571; CBS;
DR Pfam; PF01842; ACT;
DR Interpro; IPR002912; ACT;
DR Interpro; IPR000644; CBS_domain;
DR PDB; 1VR9; Identical; 15-MAR-05; CBS DOMAIN PROTEIN/ACT DOMAIN PROTEIN;
DR PDB; 2YVX; Highly similar; 04-SEP-07; MG2+ TRANSPORTER MGTE;
DR PDB; 2ZY9; Highly similar; 01-DEC-09; MG2+ TRANSPORTER MGTE;
DR FFAS; 282761; Fold and function assignment.
DR TVPC; TM0892; Homologs in PDB, JCSG and SG center.
DR OVP; TM0892; Ortholog view popup.
DR TPM; TM0892; Target PDB monitor.
DR FSS; TM0892; Target function coverage.
PROPERTY Residues: 201 aa
Molecule Weight: 22891.12 Dalton
Isoelectric Point: 4.81
Extinction Coefficient: 8480
Gravy Index: -.12
Number of Met residues: 5
Percentage of Met residues: 2.49 %
Number of Cys residues: 2
Percentage of Cys residues: 1.00 %
SEQUENCE  amino acids 201 aa
>TM0892  TM0892 hypothetical protein
MKVKKWVTQDFPMVEESATVRECLHRMRQYQTNECIVKDREGHFRGVVNKEDLLDLDLDS
SVFNKVSLPDFFVHEEDNITHALLLFLEHQEPYLPVVDEEMRLKGAVSLHDFLEALIEAL
AMDVPGIRFSVLLEDKPGELRKVVDALALSNINILSVITTRSGDGKREVLIKVDAVDEGT
LIKLFESLGIKIESIEKEEGF

CDS  cDNA 603 bp
   1 atgaaagtca aaaaatgggt cacccaggac ttcccgatgg ttgaagaatc agctacagtg    60
  61 agagaatgtc tgcacaggat gaggcagtac cagacgaacg aatgtattgt caaagatcgg   120
 121 gaaggccact tcagaggagt ggtgaacaag gaggatttgc tggatctgga tcttgattct   180
 181 tctgtattca ataaagtttc tcttccggac tttttcgtcc acgaagaaga caacatcacc   240
 241 cacgctcttc ttctgtttct ggagcaccag gagccttacc ttccggtggt tgatgaagag   300
 301 atgcgcctca agggtgctgt gagtcttcat gattttcttg aagcgctcat agaggctctg   360
 361 gcgatggacg ttcctggtat ccgtttttct gtccttctcg aggacaaacc tggagagttg   420
 421 aggaaggttg tagatgcctt agcgctcagt aacataaaca tcttatccgt tatcacaaca   480
 481 aggtcaggag atggcaagag agaggttctc atcaaagtgg acgcggtaga tgaaggaaca   540
 541 ctcatcaagc tttttgaaag tcttgggata aaaatagaat ccatcgaaaa ggaagagggg   600
 601 ttc   603
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
915026 915631 2 Glimmer3 score 9.3 poor
Genemark probabilities .86   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu