LOADING...
   TM0881;TM0881
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0881    TM0881            JCSG 359866 PDB Deposition 06-MAY-19              PDB id: 2h2w

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0881
DESCRIPTIONHomoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine O- transsuccinylase) (HTS).
ORGANISMThermotoga maritima
COMMENTPerfect genome and functional context - cluster with TM0882 - O-acetylhomoserine sulfhydrylase (EC 2.5.1.49)
------------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: SUCCINYL-COA + L-HOMOSERINE = COA + O-
SUCCINYL-L-HOMOSERINE.
-!- PATHWAY: METHIONINE BIOSYNTHESIS; HTS VARIANT; FIRST STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE HTS FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; META_THEMA
DR SPTR; Q9WZY3 (flat text); Q9WZY3 (good view)
DR GenBank; AAD35962
DR Pfam; PF04204; HTS;
DR Interpro; IPR005697; Homser_suc_trans;
DR PDB; 2H2W; Identical; 18-JUL-06; HOMOSERINE O-SUCCINYLTRANSFERASE;
DR PDB; 2GHR; Highly similar; 11-APR-06; HOMOSERINE O-SUCCINYLTRANSFERASE;
DR PDB; 2VDJ; Highly similar; 22-JAN-08; HOMOSERINE O-SUCCINYLTRANSFERASE;
DR KEGG; 2.3.1.46; Enzyme page
DR FFAS; 282750; Fold and function assignment.
DR TVPC; TM0881; Homologs in PDB, JCSG and SG center.
DR OVP; TM0881; Ortholog view popup.
DR TPM; TM0881; Target PDB monitor.
DR FSS; TM0881; Target function coverage.
PROPERTY Residues: 304 aa
Molecule Weight: 35757.29 Dalton
Isoelectric Point: 6.07
Extinction Coefficient: 66810
Gravy Index: -.34
Number of Met residues: 5
Percentage of Met residues: 1.64 %
Number of Cys residues: 2
Percentage of Cys residues: 0.66 %
SEQUENCE  amino acids 304 aa
>TM0881  TM0881 homoserine O-succinyltransferase (metA)
MPINVPSGLPAVKVLAKEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGN
TPLQVNVTLLYTETHKPKHTPIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDY
WEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYELPQKLSGVYKHRVAKDSVLFR
GHDDFFWAPHSRYTEVKKEDIDKVPELEILAESDEAGVYVVANKSERQIFVTGHPEYDRY
TLRDEYYRDIGRNLKVPIPANYFPNDDPTKTPILTWWSHAHLFFSNWLNYCIYQKTPYRL
EDIH

CDS  cDNA 912 bp
   1 ttgccaataa acgttccaag cggtcttcct gctgtgaaag tcttggcaaa agagggcatt    60
  61 ttcgttatga cggaaaagag ggcgatccac caggacatcc gccctcttga aattctcatt   120
 121 ctgaacctga tgccagacaa aataaaaacg gagattcaac ttctcagact ccttggaaac   180
 181 actcctcttc aggtgaatgt gaccttactc tacaccgaaa ctcacaaacc gaaacacact   240
 241 cccattgaac acattctaaa gttctacaca actttttccg ctgttaaaga tagaaaattc   300
 301 gatggattca tcatcacggg cgctcccgtg gaactccttc cgttcgaaga agtggattac   360
 361 tgggaagaac tcacagaaat catggaatgg agccgtcaca acgtgtactc gaccatgttc   420
 421 atctgttggg cggctcaggc gggactgtac tacttctacg gaataccgaa gtacgaactc   480
 481 ccacagaagc tctcaggcgt ttacaagcac agagtcgcaa aagattcggt cctcttcagg   540
 541 gggcacgacg acttcttctg ggcgccgcac tcgcggtaca ccgaggtgaa gaaggaagac   600
 601 atagacaaag taccggagct tgagatcctt gcagagtcgg acgaagctgg tgtttacgtg   660
 661 gttgcaaaca aaagcgaaag acagatattc gtcacaggac atcccgagta cgacagatac   720
 721 acactgagag acgaatacta tcgagatata ggtcgaaatc tgaaggtgcc gattcctgcc   780
 781 aattactttc caaacgacga tcccacaaaa actcccattc tcacttggtg gagtcacgct   840
 841 cacctcttct tcagcaactg gttgaattac tgcatctacc agaaaacacc ttacagattg   900
 901 gaagacatac ac   912
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
903444 904358 -3 Glimmer3 score 8.56 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu