LOADING...
   TM0875;TM0875
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0875    TM0875            JCSG 282744 PDB Deposition 03-FEB-15              PDB id: 1o22

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0875
DESCRIPTIONAn orphan protein with a new fold from Thermotoga maritima.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZX8_THEMA
DR SPTR; Q9WZX8 (flat text); Q9WZX8 (good view)
DR GenBank; AAD35956
DR PDB; 1O22; Identical; 01-APR-03; ORPHAN PROTEIN TM0875;
DR FFAS; 282744; Fold and function assignment.
DR TVPC; TM0875; Homologs in PDB, JCSG and SG center.
DR OVP; TM0875; Ortholog view popup.
DR TPM; TM0875; Target PDB monitor.
DR FSS; TM0875; Target function coverage.
PROPERTY Residues: 158 aa
Molecule Weight: 18578.46 Dalton
Isoelectric Point: 4.78
Extinction Coefficient: 29910
Gravy Index: -.36
Number of Met residues: 5
Percentage of Met residues: 3.16 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 158 aa
>TM0875  TM0875 hypothetical protein
MRLMDILEILYYKKGKEFGILEKKMKEIFNETGVSLEPVNSELIGRIFLKISVLEEGEEV
PSFAIKALTPKENAVDLPLGDWTDLKNVFVEEIDYLDSYGDMKILSEKNWYKIYVPYSSV
KKKNRNELVEEFMKYFFESKGWNPGEYTFSVQEIDNLF

CDS  cDNA 474 bp
   1 atgagattga tggacatcct tgaaatactc tactacaaaa aaggaaaaga atttggtatt    60
  61 ctcgagaaga aaatgaaaga gattttcaac gaaacgggtg tgagcctcga gccggtgaat   120
 121 tctgaactga ttggaagaat ttttctcaag atcagcgtcc tggaagaagg agaagaagta   180
 181 ccaagtttcg ccataaaagc tctcacaccg aaagaaaacg ctgtcgatct cccgctcgga   240
 241 gactggacag acttgaaaaa cgtctttgtt gaggaaatcg actacctcga ttcttatggt   300
 301 gatatgaaaa tactatcgga gaaaaactgg tacaaaattt acgttccata ttcttcagtg   360
 361 aagaagaaaa acaggaacga gttagtggaa gagttcatga agtacttttt tgaatcgaaa   420
 421 ggatggaatc ctggagagta cacgttttct gtccaagaaa tagacaatct gttc   474
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
898099 898575 -1 Glimmer3 score 14.96 good
Genemark probabilities .89   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu