LOADING...
   TM0874;TM0874
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0874    TM0874            JCSG 282743 PDB Deposition 05-JUL-02              PDB id: 2a6a

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0874
DESCRIPTIONGlycoprotein endopeptidase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZX7_THEMA
DR SPTR; Q9WZX7 (flat text); Q9WZX7 (good view)
DR GenBank; AAD35955
DR Pfam; PF00814; Peptidase_M22;
DR Interpro; IPR000905; Peptidase_M22;
DR PDB; 2A6A; Identical; 19-JUL-05; HYPOTHETICAL PROTEIN TM0874;
DR FFAS; 282743; Fold and function assignment.
DR TVPC; TM0874; Homologs in PDB, JCSG and SG center.
DR OVP; TM0874; Ortholog view popup.
DR TPM; TM0874; Target PDB monitor.
DR FSS; TM0874; Target function coverage.
PROPERTY Residues: 206 aa
Molecule Weight: 22985.58 Dalton
Isoelectric Point: 6.35
Extinction Coefficient: 17420
Gravy Index: -.13
Number of Met residues: 2
Percentage of Met residues: 0.97 %
Number of Cys residues: 2
Percentage of Cys residues: 0.97 %
SEQUENCE  amino acids 206 aa
>TM0874  TM0874 conserved hypothetical protein
MNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGV
GIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYC
AVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKT
IHYYEIEPLYLQKSIAELNWEKKKRG

CDS  cDNA 618 bp
   1 atgaacgttc tggcactcga cacttcccag agaataagaa ttgggttgag aaaaggagaa    60
  61 gatctttttg aaatttccta cacaggtgag aaaaaacacg cagagattct tcctgttgtt   120
 121 gtaaagaagc tgctggacga actggatctc aaagtgaaag atctcgatgt tgtgggagtg   180
 181 ggaattggcc ctggaggatt gacaggtctc agggtgggaa tcgccaccgt ggtggggctt   240
 241 gtgtctccat acgatatacc cgtggctcct ctgaactcct tcgaaatgac tgcaaagagc   300
 301 tgtccagctg acggtgttgt actcgtggct agaagagcga ggaaaggtta ccactattgt   360
 361 gcggtttatc tgaaggacaa aggactcaat ccgctgaaag agccgagtgt ggtctctgac   420
 421 gaagaactgg aagagatcac aaaagagttt tctccaaaaa tagtcctgaa ggacgacctt   480
 481 ctcatctcac ccgctgtgtt ggttgaagag agcgagaggc ttttcagaga gaaaaagacc   540
 541 atacactact acgaaatcga acctttgtat cttcagaaat ccatagcgga attgaactgg   600
 601 gaaaaaaaga aaaggggc   618
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
897469 898089 -1 Glimmer3 score 12.35 good
Genemark probabilities .92   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu