LOADING...
   TM0855;TM0855
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0855    TM0855            JCSG 282725 PDB Deposition 10-JUN-16              PDB id: 2kzf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0855
DESCRIPTIONRibosome-binding factor A.
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: ASSOCIATES WITH FREE 30S RIBOSOMAL SUBUNITS (BUT NOT
WITH 30S SUBUNITS THAT ARE PART OF 70S RIBOSOMES OR POLYSOMES).
ESSENTIAL FOR EFFICIENT PROCESSING OF 16S RRNA. MAY INTERACT WITH
THE 5'TERMINAL HELIX REGION OF 16S RRNA (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (POTENTIAL).
-!- SIMILARITY: BELONGS TO THE RBFA FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; RBFA_THEMA
DR SPTR; Q9WZV9 (flat text); Q9WZV9 (good view)
DR GenBank; AAD35937
DR Pfam; PF02033; RBFA;
DR Interpro; IPR000238; Rib_bind_factA;
DR PDB; 2KZF; Identical; 11-AUG-10; RIBOSOME-BINDING FACTOR A;
DR PDB; 1KKG; Highly similar; 18-MAR-03; RIBOSOME-BINDING FACTOR A;
DR PDB; 1JOS; Highly similar; 24-JUN-03; RIBOSOME-BINDING FACTOR A;
DR FFAS; 282725; Fold and function assignment.
DR TVPC; TM0855; Homologs in PDB, JCSG and SG center.
DR OVP; TM0855; Ortholog view popup.
DR TPM; TM0855; Target PDB monitor.
DR FSS; TM0855; Target function coverage.
PROPERTY Residues: 131 aa
Molecule Weight: 15546.15 Dalton
Isoelectric Point: 7.83
Extinction Coefficient: 8940
Gravy Index: -.73
Number of Met residues: 3
Percentage of Met residues: 2.29 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 131 aa
>TM0855  TM0855 ribosome binding factor A
MNPAYRKAMLESEIQKLLMEALQQLRDPRLKKDFVTFSRVELSKDKRYADVYVSFLGTPE
ERKETVEILNRAKGFFRTFIAKNLRLYVAPEIRFYEDKGIEASVKVHQLLVQLGYDPLKD
KEKKEEDKEEE

CDS  cDNA 393 bp
   1 atgaacccag cctatagaaa agccatgctc gaatcggaga ttcaaaaact tttgatggaa    60
  61 gcacttcaac agctgagaga tccccgcttg aagaaagatt tcgtcacgtt ttccagagtg   120
 121 gaactctcaa aggacaaaag gtacgcagac gtctatgtca gtttcctcgg cacaccggaa   180
 181 gaacgaaagg aaacggttga aatattgaac agagcgaagg gttttttcag gacctttatc   240
 241 gccaaaaatc tgagactcta cgttgctccc gaaattcgct tttacgagga caaaggcata   300
 301 gaggcgagtg taaaagttca ccagctgctg gttcaacttg gatacgatcc tctgaaggac   360
 361 aaagaaaaga aagaggagga taaggaagaa gaa   393
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
880623 881018 3 Glimmer3 score 12.02 good
Genemark probabilities .89   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu