LOADING...
   TM0831;TM0831
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0831    TM0831            JCSG 282701 PDB Deposition 08-APR-10              PDB id: 3csw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0831
DESCRIPTIONProbable branched-chain amino acid aminotransferase (EC 2.6.1.42) (BCAT).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: ACTS ON LEUCINE, ISOLEUCINE AND VALINE (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: L-LEUCINE + 2-OXOGLUTARATE = 4-METHYL-2-
OXOPENTANOATE + L-GLUTAMATE.
-!- COFACTOR: PYRIDOXAL PHOSPHATE.
-!- PATHWAY: VALINE AND ISOLEUCINE BIOSYNTHESIS.
-!- SIMILARITY: BELONGS TO CLASS-IV OF PYRIDOXAL-PHOSPHATE-DEPENDENT
AMINOTRANSFERASES.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; ILVE_THEMA
DR SPTR; P74921 (flat text); P74921 (good view)
DR GenBank; AAD35913
DR Pfam; PF01063; Aminotran_4;
DR Interpro; IPR001544; Aminotrans_IV;
DR PDB; 3CSW; Identical; 22-APR-08; PUTATIVE BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERA CHAIN: A,;
DR PDB; 1A3G; Highly similar; 27-MAY-98; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 1I1K; Highly similar; 04-JUL-01; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 1I1L; Highly similar; 04-JUL-01; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 1I1M; Highly similar; 04-JUL-01; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 1IYD; Highly similar; 06-MAY-03; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 1IYE; Highly similar; 06-MAY-03; BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE;
DR PDB; 3U0G; Highly similar; 09-NOV-11; PUTATIVE BRANCHED-CHAIN AMINO ACID AMINOTRANSFERA CHAIN: A,;
DR KEGG; 2.6.1.42; Enzyme page
DR FFAS; 282701; Fold and function assignment.
DR TVPC; TM0831; Homologs in PDB, JCSG and SG center.
DR OVP; TM0831; Ortholog view popup.
DR TPM; TM0831; Target PDB monitor.
DR FSS; TM0831; Target function coverage.
PROPERTY Residues: 273 aa
Molecule Weight: 31156.17 Dalton
Isoelectric Point: 5.01
Extinction Coefficient: 36440
Gravy Index: -.01
Number of Met residues: 3
Percentage of Met residues: 1.10 %
Number of Cys residues: 2
Percentage of Cys residues: 0.73 %
SEQUENCE  amino acids 273 aa
>TM0831  TM0831 branched-chain amino acid aminotransferase, putative
MLIWWRGKFRRADEISLDFSLFEKSLQGAVYETLRTYSRAPFAAYKHYTRLKRSADFFNL
PLSLSFDEFTKVLKAGADEFKQEVRIKVYLFPDSGEVLFVFSPLNIPDLETGVEVKISNV
RRIPDLSTPPALKITGRTDIVLARREIVDCYDVILLGLNGQVCEGSFSNVFLVKEGKLIT
PSLDSGILDGITRENVIKLAKSLEIPVEERVVWVWELFEADEMFLTHTSAGVVPVRRLNE
HSFFEEEPGPVTATLMENFEPFVLNLEENWVGI

CDS  cDNA 819 bp
   1 gtgctgatat ggtggagggg aaagttccgg cgcgcggatg aaatttcact ggatttctct    60
  61 ctgtttgaaa agtcgctcca gggagcggtg tatgaaactc tgagaactta cagtagggcc   120
 121 ccgtttgcgg cttacaaaca ttacactagg ctgaaaagat ctgccgattt ctttaatctt   180
 181 cctctttctc tgagcttcga tgaattcaca aaggtgctga aggcgggagc tgatgagttc   240
 241 aaacaagaag tgagaatcaa agtctatctt ttccctgatt ccggggaggt tctctttgtg   300
 301 ttctcaccgc tcaatatacc agacctggag acaggagtcg aggtgaaaat atcgaacgtt   360
 361 cgaaggatac cggatctttc tactccacca gctctaaaaa taactggacg caccgacata   420
 421 gtgcttgcaa gaagggaaat agtggactgc tacgatgtga ttttgctcgg tttgaacggg   480
 481 caggtctgtg agggaagttt cagcaatgtg tttctggtga aagaaggcaa attgattaca   540
 541 ccatcgcttg acagcggtat tctggatggc atcacacggg aaaacgttat aaagctcgca   600
 601 aaaagtctcg agatacctgt tgaagaaaga gtagtgtggg tgtgggaact gttcgaagcg   660
 661 gatgaaatgt ttctcacaca cacaagtgcg ggagtggttc ctgtcagaag gttgaacgag   720
 721 cactcgtttt tcgaggaaga gccaggacct gtgacagcga ctttgatgga aaactttgag   780
 781 ccttttgtct taaatctgga ggaaaactgg gtgggaata   819
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
856556 857377 2 Glimmer3 score 6.69 poor
Genemark probabilities .82   .12 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu