LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0828    TM0828            JCSG 282698 PDB Deposition 05-AUG-02              PDB id: 2ajr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0828
DESCRIPTIONPossible 1-phosphofructokinase (EC 2.7.1.56)
ORGANISMThermotoga maritima
COMMENT Although the Swiss-prot annotation ( Sugar kinase, PFKB family ) is correct, it can be improved by saying:
(Possible) 1-phosphofructokinase (EC 2.7.1.56).
The strongest arguments are:
1) homology with unambiguous 1-PFKs, whose annotations are strongly supported by chromosomal clustering;
2) rejection of the Tagatose-6-phosphate kinase (EC 2.7.1.144) based on the absence of functional context.
Homologs: Among the members of the ribokinase family, the two closest homologs of TM0828 are:
1.1-phosphofructokinase (EC 2.7.1.56), and
2.Tagatose-6-phosphate kinase (EC 2.7.1.144)
Functional and genome context:
- While there is no functional context for #2 (no upstream or downstream reactions in Galactose metabolism map), the function #1 (EC 2.7.1.56) can be involved in the interconversion of Fructose-1P.
- The most common source of Fructose-1P, the PTS system (EC 2.7.1.69) seems to be absent in T.maritima. In other organisms containing 2.7.1.56, highly homologoues to TM0828, genes for this PTS system are a) present and b) tightly clustered with 2.7.1.56 (e.g. B.subtilis, C.acetobutyicum and many others). That could argue against this functional assignment.

- Alternatively Fructose-1P can be generated in gluconeogenic direction by 4.1.2.13 fructose-bisphosphate aldolase, from Glycerone phosphate + D-Glyceraldehyde by its “second” activity. The gene for this enzyme is certainly present as a part of glycolysis/gluconeogenesis system (TM0276).
DR UNIPROT; Q9WZT5_THEMA
DR SPTR; Q9WZT5 (flat text); Q9WZT5 (good view)
DR GenBank; AAD35910
DR Pfam; PF00294; PfkB;
DR Interpro; IPR002173; PfkB;
DR PDB; 2AJR; Identical; 11-OCT-05; SUGAR KINASE, PFKB FAMILY;
DR PDB; 2ABQ; Highly similar; 02-AUG-05; FRUCTOSE 1-PHOSPHATE KINASE;
DR FFAS; 282698; Fold and function assignment.
DR TVPC; TM0828; Homologs in PDB, JCSG and SG center.
DR OVP; TM0828; Ortholog view popup.
DR TPM; TM0828; Target PDB monitor.
DR FSS; TM0828; Target function coverage.
PROPERTY Residues: 319 aa
Molecule Weight: 35866.53 Dalton
Isoelectric Point: 6.28
Extinction Coefficient: 23380
Gravy Index: -.12
Number of Met residues: 8
Percentage of Met residues: 2.51 %
Number of Cys residues: 2
Percentage of Cys residues: 0.63 %
SEQUENCE  amino acids 319 aa
>TM0828  TM0828 sugar kinase, pfkB family
MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
PDLEAIKKEYDHFTVERVK

CDS  cDNA 957 bp
   1 atggtcctga cggtgaccct caatcccgct ttagacaggg aaattttcat agaagatttc    60
  61 caggtgaaca ggctgtacag gataaatgat ctttctaaaa ctcaaatgtc cccaggtgga   120
 121 aagggtataa acgtttctat agctctttcc aaattgggag tgccgtcagt cgccaccgga   180
 181 ttcgtgggtg ggtacatggg aaagattctt gtggaagaat tgagaaaaat ttcaaagctg   240
 241 atcacaacga attttgttta cgtggaggga gaaacgaggg aaaacatcga aataatcgat   300
 301 gaaaagaata aaacaataac cgctatcaat tttcccggtc cggatgttac ggatatggat   360
 361 gtgaatcact ttctgagaag atacaagatg acgctttcga aagtcgattg cgttgttata   420
 421 tcggggagta ttccaccggg agtaaacgag ggaatatgca acgaactggt gagactcgcg   480
 481 cgtgaaagag gagtctttgt ctttgtcgaa cagactccca gattgcttga aagaatttat   540
 541 gaggggccag aatttcccaa cgtcgtgaaa ccagatttga gaggtaatca tgcttctttt   600
 601 cttggtgttg atttgaaaac ctttgacgat tacgtgaaac tcgccgaaaa gctcgccgaa   660
 661 aaatcgcagg tttccgtggt gtcatacgaa gtgaagaacg atattgttgc aacaagagaa   720
 721 ggggtctggc ttataagatc caaagaagaa atagacacat cacatcttct gggtgcggga   780
 781 gacgcgtatg tagctggtat ggtctattac ttcattaaac acggagccaa cttcctcgaa   840
 841 atggcaaaat ttggttttgc ctccgcactg gctgccacta gaagaaagga aaaatacatg   900
 901 cccgaccttg aggcgataaa gaaggaatac gatcacttca ccgtagagag ggtgaag   957
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
853883 854842 2 Glimmer3 score 11.34 poor
Genemark probabilities .9   .72 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu