LOADING...
   TM0820;TM0820
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0820    TM0820            JCSG 282690 PDB Deposition 04-JUL-28              PDB id: 1vlj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0820
DESCRIPTIONNADH-dependent butanol dehydrogenase A (EC 1.1.1.-)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9WZS7_THEMA
DR SPTR; Q9WZS7 (flat text); Q9WZS7 (good view)
DR GenBank; AAD35902
DR Pfam; PF00465; Fe-ADH;
DR Interpro; IPR001670; Fe-ADH;
DR PDB; 1VLJ; Identical; 17-AUG-04; NADH-DEPENDENT BUTANOL DEHYDROGENASE;
DR PDB; 1OJ7; Highly similar; 08-JUL-04; HYPOTHETICAL OXIDOREDUCTASE YQHD;
DR PDB; 4FR2; Highly similar; 05-JUN-13; 1,3-PROPANEDIOL DEHYDROGENASE;
DR KEGG; 1.1.1.-; Enzyme page
DR FFAS; 282690; Fold and function assignment.
DR TVPC; TM0820; Homologs in PDB, JCSG and SG center.
DR OVP; TM0820; Ortholog view popup.
DR TPM; TM0820; Target PDB monitor.
DR FSS; TM0820; Target function coverage.
PROPERTY Residues: 395 aa
Molecule Weight: 43352.81 Dalton
Isoelectric Point: 6.7
Extinction Coefficient: 52370
Gravy Index: -.11
Number of Met residues: 8
Percentage of Met residues: 2.03 %
Number of Cys residues: 1
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 395 aa
>TM0820  TM0820 NADH-dependent butanol dehydrogenase, putative
MENFVFHNPTKIVFGRGTIPKIGEEIKNAGIRKVLFLYGGGSIKKNGVYDQVVDSLKKHG
IEWVEVSGVKPNPVLSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAKAVAAGALYEGDIWD
AFIGKYQIEKALPIFDVLTISATGTEMNGNAVITNEKTKEKYGVSSKALYPKVSIIDPSV
QFTLPKEQTVYGAVDAISHILEYYFDGSSPEISNEIAEGTIRTIMKMTERLIEKPDDYEA
RANLAWSATIALNGTMAVGRRGGEWACHRIEHSLSALYDIAHGAGLAIVFPAWMKYVYRK
NPAQFERFAKKIFGFEGEGEELILKGIEAFKNWLKKVGAPVSLKDAGIPEEDIDKIVDNV
MLLVEKNLKPKGASLGRIMVLEREDVREILKLAAK

CDS  cDNA 1185 bp
   1 atggagaact tcgtcttcca caatcccacg aagatcgtct ttggaagagg aacgattcca    60
  61 aaaataggag aagagataaa gaacgcggga atcagaaagg tgctgttcct atacggtggt   120
 121 ggatcgataa agaaaaatgg cgtttatgat caggttgtcg attcactgaa aaagcacgga   180
 181 atagagtggg tagaagtatc tggtgtcaag ccgaatccag tcctttccaa ggtccacgaa   240
 241 gccgtcgagg tggcgaaaaa agaaaaggtg gaggctgttc ttggtgttgg tggaggaagc   300
 301 gttgtggatt ctgcaaaagc agtagcggct ggtgctctct acgagggcga catatgggat   360
 361 gcttttatcg gtaaatacca gatcgagaaa gcccttccta ttttcgacgt gctcacaatc   420
 421 tcggcgacag gaacggagat gaacggtaac gctgtgataa cgaacgagaa aacgaaggaa   480
 481 aaatatggag tgagttcgaa ggctctctat ccaaaagtat ccataatcga tccttctgtt   540
 541 caattcactc ttccaaaaga acaaacagtt tatggagcgg tggatgcgat ctcacacatc   600
 601 ctcgagtact atttcgatgg gagcagtcct gagatctcca acgaaatagc ggaaggtact   660
 661 atcagaacga tcatgaaaat gacagaaagg ttgatagaaa aaccggatga ctacgaagca   720
 721 agggcaaatc tcgcgtggtc tgcaacgatc gctctcaatg gaacgatggc agtcggaaga   780
 781 aggggcggag agtgggcttg tcacaggatc gagcactccc tcagcgctct ttacgatatt   840
 841 gcacacggag cgggtctcgc cattgtgttt ccggcgtgga tgaagtatgt gtacagaaag   900
 901 aatcctgcgc agttcgaaag gtttgcgaaa aaaatcttcg gatttgaggg tgagggagag   960
 961 gaactgattc tgaaagggat agaagctttc aaaaactggc tgaagaaggt aggagctcct  1020
1021 gtgtccctca aagatgcggg aatcccagaa gaagacatag acaagatcgt ggacaacgtc  1080
1081 atgcttcttg tggaaaagaa tctgaaacct aaaggagcga gtttgggaag aataatggtg  1140
1141 ctcgaaagag aagacgttcg tgaaatattg aaattagcgg cgaaa  1185
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
845079 846266 3 Glimmer3 score 12.25 good
Genemark probabilities .93   .85 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu