LOADING...
   TM0816;TM0816
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0816    TM0816            JCSG 282686 PDB Deposition 05-OCT-27              PDB id: 2eth

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM0816
DESCRIPTIONPutative transcriptional regulator from the MarR family
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE MARR FAMILY OF TRANSCRIPTIONAL
REGULATORS.
DR UNIPROT; Q9WZS3_THEMA
DR SPTR; Q9WZS3 (flat text); Q9WZS3 (good view)
DR GenBank; AAD35898
DR Pfam; PF01047; MarR;
DR Interpro; IPR000835; HTH_MarR;
DR PDB; 2ETH; Identical; 08-NOV-05; TRANSCRIPTIONAL REGULATOR, PUTATIVE, MAR FAMILY;
DR PDB; 2A61; Highly similar; 19-JUL-05; TRANSCRIPTIONAL REGULATOR TM0710;
DR PDB; 2RDP; Highly similar; 13-NOV-07; PUTATIVE TRANSCRIPTIONAL REGULATOR MARR;
DR PDB; 3GFJ; Highly similar; 25-AUG-09; 146AA LONG HYPOTHETICAL TRANSCRIPTIONAL REGULATOR;
DR PDB; 3GFL; Highly similar; 25-AUG-09; 146AA LONG HYPOTHETICAL TRANSCRIPTIONAL REGULATOR;
DR PDB; 3F3X; Highly similar; 05-MAY-09; TRANSCRIPTIONAL REGULATOR, MARR FAMILY, PUTATIVE;
DR FFAS; 282686; Fold and function assignment.
DR TVPC; TM0816; Homologs in PDB, JCSG and SG center.
DR OVP; TM0816; Ortholog view popup.
DR TPM; TM0816; Target PDB monitor.
DR FSS; TM0816; Target function coverage.
PROPERTY Residues: 142 aa
Molecule Weight: 16386.06 Dalton
Isoelectric Point: 5.22
Extinction Coefficient: 5960
Gravy Index: -.19
Number of Met residues: 6
Percentage of Met residues: 4.23 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 142 aa
>TM0816  TM0816 transcriptional regulator, putative, Mar family
MDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTK
SNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSE
EDFKVVSEGFNRMVEALSREGR

CDS  cDNA 426 bp
   1 atggatgctc tggagatatt caaaacactc ttttcgctgg tgatgaggtt ttccagttat    60
  61 cttccatcga acgaagagat ctctgacatg aaaacaacgg agctctacgc gttcctctac   120
 121 gtggctctct tcggcccaaa aaagatgaaa gagatagcgg agtttctttc cacaacgaag   180
 181 agcaacgtaa cgaacgtggt ggattctttg gagaaaagag gcctggtcgt cagagagatg   240
 241 gaccccgttg atagaaggac gtaccgggtg gtcttgaccg aaaagggaaa ggaaatcttc   300
 301 ggagagattc tttcgaactt cgaaagtctt ttgaaaagtg ttcttgagaa attttccgag   360
 361 gaagacttca aagtggtgag cgaaggattc aatcgaatgg tggaagctct gtcgagggag   420
 421 ggaagg   426
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
840426 840854 3 Glimmer3 score 16.57 good
Genemark probabilities .89   .93 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu